Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397JL83

Protein Details
Accession A0A397JL83    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
56-81KYQQLCKHFKQKTKKYNRIKRSLDLYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto 9.5, cyto_pero 5.5
Family & Domain DBs
Amino Acid Sequences MANEGILKELEEELEKNLNEATANNDNSEEIISSYTTKTISADVLSIKYKIETLNKYQQLCKHFKQKTKKYNRIKRSLDLYIMKANEIFKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.16
5 0.15
6 0.14
7 0.14
8 0.17
9 0.19
10 0.2
11 0.2
12 0.2
13 0.2
14 0.19
15 0.19
16 0.13
17 0.07
18 0.07
19 0.07
20 0.08
21 0.08
22 0.08
23 0.08
24 0.08
25 0.08
26 0.08
27 0.08
28 0.07
29 0.08
30 0.08
31 0.09
32 0.1
33 0.1
34 0.09
35 0.08
36 0.09
37 0.1
38 0.15
39 0.17
40 0.22
41 0.32
42 0.36
43 0.38
44 0.41
45 0.43
46 0.45
47 0.48
48 0.47
49 0.48
50 0.5
51 0.57
52 0.65
53 0.71
54 0.75
55 0.8
56 0.85
57 0.86
58 0.9
59 0.92
60 0.91
61 0.87
62 0.83
63 0.79
64 0.74
65 0.7
66 0.63
67 0.57
68 0.53
69 0.47
70 0.41
71 0.35