Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397H2F6

Protein Details
Accession A0A397H2F6    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
22-49NSAKLSRHARACKNKKQRREQEQIATQHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 5.5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MQASINKRKVYTVISQGVPVANSAKLSRHARACKNKKQRREQEQIATQHEPEYPLLPTDRNSSKESKTQQEISTRDLLVETLIREVKPVSNNPLGVNISLEIKKDSWNRSDVLSLEIKKAVKVFLFYQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.37
4 0.35
5 0.3
6 0.24
7 0.17
8 0.11
9 0.12
10 0.12
11 0.14
12 0.2
13 0.24
14 0.28
15 0.35
16 0.43
17 0.51
18 0.61
19 0.69
20 0.72
21 0.79
22 0.83
23 0.84
24 0.88
25 0.88
26 0.87
27 0.87
28 0.83
29 0.81
30 0.81
31 0.76
32 0.7
33 0.61
34 0.51
35 0.43
36 0.36
37 0.28
38 0.21
39 0.16
40 0.11
41 0.11
42 0.11
43 0.11
44 0.11
45 0.15
46 0.18
47 0.2
48 0.22
49 0.25
50 0.26
51 0.32
52 0.35
53 0.34
54 0.35
55 0.35
56 0.36
57 0.39
58 0.39
59 0.36
60 0.35
61 0.3
62 0.26
63 0.22
64 0.19
65 0.13
66 0.12
67 0.09
68 0.08
69 0.1
70 0.09
71 0.1
72 0.11
73 0.13
74 0.16
75 0.18
76 0.22
77 0.24
78 0.25
79 0.25
80 0.29
81 0.26
82 0.23
83 0.21
84 0.16
85 0.16
86 0.16
87 0.16
88 0.14
89 0.14
90 0.2
91 0.25
92 0.29
93 0.29
94 0.31
95 0.31
96 0.31
97 0.34
98 0.28
99 0.27
100 0.29
101 0.27
102 0.27
103 0.3
104 0.28
105 0.27
106 0.27
107 0.26
108 0.21
109 0.23