Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397JLJ9

Protein Details
Accession A0A397JLJ9    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
51-80SEDKESLRKKYNRNKFKIFKGREERRKIINBasic
NLS Segment(s)
PositionSequence
58-78RKKYNRNKFKIFKGREERRKI
Subcellular Location(s) nucl 12.5, mito 9, cyto_nucl 8.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MVCKSCRRFEGDIFCSILRVSVAFKPVYTLFSDDDDVIETDLHDEGSSSSSEDKESLRKKYNRNKFKIFKGREERRKIIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.37
3 0.32
4 0.26
5 0.15
6 0.13
7 0.12
8 0.11
9 0.14
10 0.14
11 0.13
12 0.16
13 0.16
14 0.17
15 0.16
16 0.15
17 0.13
18 0.15
19 0.16
20 0.13
21 0.13
22 0.12
23 0.11
24 0.09
25 0.08
26 0.06
27 0.06
28 0.06
29 0.05
30 0.04
31 0.04
32 0.04
33 0.06
34 0.06
35 0.06
36 0.07
37 0.07
38 0.08
39 0.09
40 0.1
41 0.17
42 0.23
43 0.29
44 0.38
45 0.44
46 0.54
47 0.64
48 0.73
49 0.76
50 0.79
51 0.83
52 0.81
53 0.85
54 0.86
55 0.82
56 0.82
57 0.82
58 0.85
59 0.85
60 0.86