Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IA95

Protein Details
Accession A0A397IA95    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
34-53YEYYKSKTKVKSKVGKCSNDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MFQERWKCLIDELARRLRDISERCINNQLESQIYEYYKSKTKVKSKVGKCSNDMEGRKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.45
3 0.45
4 0.38
5 0.4
6 0.35
7 0.34
8 0.35
9 0.36
10 0.37
11 0.43
12 0.42
13 0.35
14 0.33
15 0.27
16 0.2
17 0.19
18 0.19
19 0.13
20 0.13
21 0.14
22 0.14
23 0.16
24 0.21
25 0.23
26 0.28
27 0.35
28 0.43
29 0.51
30 0.6
31 0.68
32 0.7
33 0.78
34 0.81
35 0.78
36 0.73
37 0.69
38 0.67
39 0.66