Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397HV29

Protein Details
Accession A0A397HV29    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
12-34RAGTFCKCQREVRKQNGHKFIQQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11cyto_nucl 11, cyto 9, mito 2, pero 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000961  AGC-kinase_C  
IPR017892  Pkinase_C  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0006468  P:protein phosphorylation  
Pfam View protein in Pfam  
PF00433  Pkinase_C  
PROSITE View protein in PROSITE  
PS51285  AGC_KINASE_CTER  
Amino Acid Sequences MLETPLVAGLGRAGTFCKCQREVRKQNGHKFIQQIFYQWVNWEDMFYKKVPPPFYPLISSPTDTSNFDDEFTKELPVLTPVNSQLTADNQDEFRGFSYVSDLVVNGEKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.15
3 0.2
4 0.25
5 0.28
6 0.37
7 0.47
8 0.57
9 0.65
10 0.71
11 0.78
12 0.8
13 0.86
14 0.87
15 0.8
16 0.73
17 0.69
18 0.62
19 0.56
20 0.47
21 0.39
22 0.33
23 0.31
24 0.27
25 0.22
26 0.2
27 0.17
28 0.16
29 0.15
30 0.12
31 0.13
32 0.14
33 0.13
34 0.16
35 0.16
36 0.2
37 0.22
38 0.22
39 0.27
40 0.28
41 0.29
42 0.28
43 0.26
44 0.26
45 0.25
46 0.25
47 0.19
48 0.19
49 0.19
50 0.17
51 0.19
52 0.17
53 0.16
54 0.16
55 0.16
56 0.15
57 0.16
58 0.15
59 0.14
60 0.11
61 0.11
62 0.1
63 0.12
64 0.12
65 0.11
66 0.12
67 0.13
68 0.16
69 0.16
70 0.16
71 0.14
72 0.16
73 0.19
74 0.18
75 0.19
76 0.17
77 0.18
78 0.18
79 0.17
80 0.16
81 0.13
82 0.12
83 0.1
84 0.14
85 0.13
86 0.14
87 0.13
88 0.12
89 0.13