Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397J5W6

Protein Details
Accession A0A397J5W6    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
27-50RTTIKELSEKKKKRRFNRTLVDSLHydrophilic
NLS Segment(s)
PositionSequence
18-22KGRRA
30-41IKELSEKKKKRR
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MKEIFLQEVLEVEKRNIKGRRALGIVRTTIKELSEKKKKRRFNRTLVDSLSKVSEDVTDWDKHIPSVLFAYRIAKQATTKIEPFYLVYGRAAQFPMKFGIFLINYYCSFQISAIM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.31
3 0.35
4 0.36
5 0.42
6 0.45
7 0.5
8 0.48
9 0.49
10 0.47
11 0.45
12 0.45
13 0.4
14 0.37
15 0.32
16 0.28
17 0.26
18 0.26
19 0.27
20 0.34
21 0.42
22 0.49
23 0.58
24 0.67
25 0.75
26 0.8
27 0.85
28 0.85
29 0.84
30 0.86
31 0.83
32 0.79
33 0.73
34 0.67
35 0.55
36 0.47
37 0.37
38 0.26
39 0.19
40 0.13
41 0.1
42 0.07
43 0.08
44 0.11
45 0.1
46 0.11
47 0.12
48 0.12
49 0.12
50 0.13
51 0.11
52 0.08
53 0.11
54 0.11
55 0.11
56 0.11
57 0.14
58 0.14
59 0.17
60 0.17
61 0.16
62 0.16
63 0.2
64 0.25
65 0.27
66 0.26
67 0.25
68 0.25
69 0.24
70 0.24
71 0.22
72 0.18
73 0.15
74 0.14
75 0.16
76 0.16
77 0.17
78 0.17
79 0.17
80 0.16
81 0.17
82 0.2
83 0.16
84 0.16
85 0.14
86 0.19
87 0.17
88 0.18
89 0.19
90 0.19
91 0.2
92 0.22
93 0.22
94 0.17
95 0.17