Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397IEH9

Protein Details
Accession A0A397IEH9    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
32-61EEKEKEEKKKLKKTVFKKKKKEAKITFDLABasic
NLS Segment(s)
PositionSequence
18-55KQKGKKKVIENSDEEEKEKEEKKKLKKTVFKKKKKEAK
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MHKTKQKRFAMNEIESHKQKGKKKVIENSDEEEKEKEEKKKLKKTVFKKKKKEAKITFDLAHNLNDLTKKFEKIQLNLIQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.57
3 0.54
4 0.51
5 0.48
6 0.51
7 0.55
8 0.6
9 0.61
10 0.68
11 0.72
12 0.75
13 0.74
14 0.71
15 0.66
16 0.63
17 0.55
18 0.47
19 0.39
20 0.32
21 0.29
22 0.3
23 0.3
24 0.31
25 0.38
26 0.46
27 0.55
28 0.62
29 0.67
30 0.71
31 0.76
32 0.8
33 0.84
34 0.85
35 0.86
36 0.88
37 0.88
38 0.89
39 0.9
40 0.87
41 0.85
42 0.81
43 0.77
44 0.68
45 0.61
46 0.55
47 0.45
48 0.36
49 0.28
50 0.21
51 0.18
52 0.19
53 0.17
54 0.21
55 0.22
56 0.25
57 0.27
58 0.35
59 0.4
60 0.4
61 0.49