Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IVG5

Protein Details
Accession A0A397IVG5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
67-93ACGICLCVKKKYKKNSEKEKGEPNSKEHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, mito 9, E.R. 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIQDSFSFLILLVILFIQFPPSTPAYVNNKSNSSWTFWSYDGEHRKCANICIIVFVIISVLFTALCACGICLCVKKKYKKNSEKEKGEPNSKETDGNSMDNVYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.04
4 0.06
5 0.06
6 0.07
7 0.11
8 0.12
9 0.13
10 0.13
11 0.21
12 0.27
13 0.34
14 0.37
15 0.37
16 0.38
17 0.37
18 0.4
19 0.35
20 0.31
21 0.27
22 0.24
23 0.23
24 0.22
25 0.23
26 0.22
27 0.28
28 0.33
29 0.32
30 0.34
31 0.32
32 0.34
33 0.33
34 0.32
35 0.27
36 0.2
37 0.18
38 0.16
39 0.16
40 0.13
41 0.12
42 0.11
43 0.08
44 0.05
45 0.05
46 0.03
47 0.03
48 0.02
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.04
56 0.05
57 0.07
58 0.12
59 0.15
60 0.23
61 0.31
62 0.41
63 0.5
64 0.6
65 0.69
66 0.75
67 0.83
68 0.86
69 0.89
70 0.88
71 0.86
72 0.86
73 0.83
74 0.82
75 0.74
76 0.67
77 0.63
78 0.55
79 0.51
80 0.42
81 0.41
82 0.35
83 0.34
84 0.31