Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397INI6

Protein Details
Accession A0A397INI6    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MIAVAQYKKRIWRKMPKKKKRDEEGGCKDDFHydrophilic
NLS Segment(s)
PositionSequence
8-21KKRIWRKMPKKKKR
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018247  EF_Hand_1_Ca_BS  
PROSITE View protein in PROSITE  
PS00018  EF_HAND_1  
Amino Acid Sequences MIAVAQYKKRIWRKMPKKKKRDEEGGCKDDFDDDNNNRDDDVSEEDEDNDGMVDTREIKCLKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.88
3 0.9
4 0.92
5 0.93
6 0.94
7 0.91
8 0.91
9 0.88
10 0.88
11 0.87
12 0.8
13 0.7
14 0.59
15 0.5
16 0.41
17 0.32
18 0.23
19 0.2
20 0.17
21 0.21
22 0.22
23 0.22
24 0.2
25 0.2
26 0.18
27 0.13
28 0.16
29 0.15
30 0.15
31 0.16
32 0.16
33 0.17
34 0.16
35 0.14
36 0.09
37 0.06
38 0.06
39 0.06
40 0.06
41 0.09
42 0.1
43 0.16