Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IG06

Protein Details
Accession A0A397IG06    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
29-55NNKFYNRTHYQKNKYSNNKNNNYNNDNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MDIPNIYFIVTQKTPALAIWRFSKPNNNNNKFYNRTHYQKNKYSNNKNNNYNNDNNKSNNKGKEIKENCFKCGKPRHYAKECYTSIPITIELVDRRKQTADQVVTVSTLQLDDYKTTKARTRKALGSYHNTLECSEEVQPWKGKNSRRRVGLEGKEVEVIKGFVGNVLDEKARTRKTSNSYYNTLEHSEEVRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.25
4 0.2
5 0.24
6 0.27
7 0.32
8 0.34
9 0.36
10 0.46
11 0.47
12 0.54
13 0.62
14 0.63
15 0.63
16 0.66
17 0.72
18 0.67
19 0.63
20 0.63
21 0.59
22 0.58
23 0.63
24 0.67
25 0.68
26 0.7
27 0.76
28 0.77
29 0.81
30 0.85
31 0.85
32 0.85
33 0.85
34 0.85
35 0.84
36 0.82
37 0.78
38 0.75
39 0.73
40 0.69
41 0.64
42 0.59
43 0.56
44 0.55
45 0.56
46 0.52
47 0.49
48 0.51
49 0.49
50 0.56
51 0.55
52 0.55
53 0.58
54 0.56
55 0.53
56 0.51
57 0.49
58 0.47
59 0.52
60 0.51
61 0.5
62 0.58
63 0.64
64 0.65
65 0.72
66 0.67
67 0.66
68 0.62
69 0.55
70 0.48
71 0.38
72 0.32
73 0.25
74 0.21
75 0.12
76 0.11
77 0.1
78 0.1
79 0.13
80 0.16
81 0.16
82 0.16
83 0.17
84 0.17
85 0.18
86 0.24
87 0.22
88 0.2
89 0.2
90 0.19
91 0.19
92 0.19
93 0.15
94 0.08
95 0.06
96 0.05
97 0.06
98 0.06
99 0.07
100 0.08
101 0.11
102 0.12
103 0.14
104 0.2
105 0.26
106 0.32
107 0.38
108 0.42
109 0.46
110 0.5
111 0.55
112 0.55
113 0.55
114 0.53
115 0.48
116 0.44
117 0.39
118 0.33
119 0.28
120 0.23
121 0.18
122 0.16
123 0.16
124 0.17
125 0.2
126 0.23
127 0.22
128 0.29
129 0.32
130 0.39
131 0.45
132 0.54
133 0.57
134 0.61
135 0.65
136 0.65
137 0.69
138 0.68
139 0.67
140 0.58
141 0.52
142 0.49
143 0.44
144 0.37
145 0.28
146 0.22
147 0.14
148 0.12
149 0.11
150 0.09
151 0.09
152 0.09
153 0.09
154 0.11
155 0.12
156 0.11
157 0.16
158 0.22
159 0.25
160 0.29
161 0.31
162 0.38
163 0.44
164 0.55
165 0.6
166 0.59
167 0.6
168 0.61
169 0.61
170 0.56
171 0.51
172 0.42
173 0.34