Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397GZL8

Protein Details
Accession A0A397GZL8    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-29LLNQIFKSKYFHKHKRNSFKGRTSFPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MYVLLNQIFKSKYFHKHKRNSFKGRTSFPIKNDGINIDKTVKAEDQDVDDDDEDDEDNAVELEDMEDDSDDEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.62
3 0.71
4 0.81
5 0.86
6 0.9
7 0.91
8 0.89
9 0.88
10 0.84
11 0.78
12 0.74
13 0.7
14 0.64
15 0.56
16 0.55
17 0.46
18 0.4
19 0.36
20 0.32
21 0.27
22 0.23
23 0.22
24 0.15
25 0.16
26 0.15
27 0.15
28 0.13
29 0.12
30 0.12
31 0.12
32 0.12
33 0.13
34 0.14
35 0.14
36 0.13
37 0.13
38 0.12
39 0.11
40 0.09
41 0.08
42 0.07
43 0.05
44 0.05
45 0.05
46 0.05
47 0.04
48 0.04
49 0.04
50 0.05
51 0.05
52 0.05
53 0.06