Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397HPH9

Protein Details
Accession A0A397HPH9    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
40-65RDTQSCKNRHQYLKRRKRRPADWSEEHydrophilic
NLS Segment(s)
PositionSequence
53-58KRRKRR
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017930  Myb_dom  
IPR001005  SANT/Myb  
Pfam View protein in Pfam  
PF00249  Myb_DNA-binding  
PROSITE View protein in PROSITE  
PS51294  HTH_MYB  
PS50090  MYB_LIKE  
CDD cd00167  SANT  
Amino Acid Sequences MTEETSKRHQWSSQEDTRLKFLIEQYGTAWAKISTHLPGRDTQSCKNRHQYLKRRKRRPADWSEEDEALLKQFVKKHSKAFTEVWRAVAKNVPHKTWQQCEKRWNIINSDGNSATK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.59
3 0.58
4 0.57
5 0.51
6 0.42
7 0.36
8 0.3
9 0.29
10 0.26
11 0.24
12 0.21
13 0.29
14 0.29
15 0.26
16 0.24
17 0.16
18 0.16
19 0.16
20 0.17
21 0.12
22 0.18
23 0.19
24 0.2
25 0.23
26 0.28
27 0.34
28 0.36
29 0.4
30 0.43
31 0.47
32 0.5
33 0.56
34 0.59
35 0.6
36 0.67
37 0.71
38 0.74
39 0.79
40 0.85
41 0.85
42 0.86
43 0.87
44 0.85
45 0.84
46 0.82
47 0.8
48 0.75
49 0.71
50 0.65
51 0.56
52 0.48
53 0.38
54 0.29
55 0.2
56 0.15
57 0.09
58 0.08
59 0.12
60 0.18
61 0.25
62 0.27
63 0.34
64 0.4
65 0.43
66 0.45
67 0.47
68 0.49
69 0.5
70 0.49
71 0.46
72 0.42
73 0.39
74 0.36
75 0.36
76 0.32
77 0.33
78 0.36
79 0.35
80 0.37
81 0.44
82 0.5
83 0.54
84 0.6
85 0.59
86 0.63
87 0.69
88 0.73
89 0.75
90 0.75
91 0.7
92 0.65
93 0.64
94 0.65
95 0.58
96 0.57