Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397J7L7

Protein Details
Accession A0A397J7L7    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
72-101KIANRYNYICRQRQKRRYRRNINVNDYPNHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 12.5, cyto 4, cysk 2
Family & Domain DBs
Amino Acid Sequences MEMSVDIDNLPLSAQSLYEYMRRRNFYINGKNVLFLELEFLERLKNTQKSLKVTCNNLWESATSEQRRSLDKIANRYNYICRQRQKRRYRRNINVNDYPNHDSFDLINGSSFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.08
4 0.1
5 0.16
6 0.2
7 0.26
8 0.34
9 0.37
10 0.38
11 0.43
12 0.48
13 0.53
14 0.58
15 0.57
16 0.56
17 0.53
18 0.51
19 0.45
20 0.4
21 0.29
22 0.19
23 0.16
24 0.1
25 0.1
26 0.09
27 0.09
28 0.08
29 0.08
30 0.1
31 0.13
32 0.15
33 0.17
34 0.23
35 0.27
36 0.32
37 0.37
38 0.44
39 0.42
40 0.44
41 0.45
42 0.44
43 0.41
44 0.36
45 0.32
46 0.24
47 0.23
48 0.21
49 0.25
50 0.21
51 0.21
52 0.23
53 0.24
54 0.26
55 0.26
56 0.27
57 0.27
58 0.29
59 0.37
60 0.43
61 0.45
62 0.44
63 0.43
64 0.45
65 0.48
66 0.52
67 0.51
68 0.51
69 0.58
70 0.67
71 0.76
72 0.81
73 0.83
74 0.87
75 0.91
76 0.94
77 0.94
78 0.94
79 0.94
80 0.92
81 0.9
82 0.84
83 0.76
84 0.71
85 0.65
86 0.55
87 0.47
88 0.38
89 0.3
90 0.24
91 0.26
92 0.21
93 0.16