Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IDJ1

Protein Details
Accession A0A397IDJ1    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
16-37VLYDKKTKKIWVSKRINLNKEFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011646  KAP_P-loop  
IPR027417  P-loop_NTPase  
Pfam View protein in Pfam  
PF07693  KAP_NTPase  
Amino Acid Sequences MTTLNKIKIIEYTTTVLYDKKTKKIWVSKRINLNKEFYEHWQSPERHVEESDISTKWVARREEMTHWELKKSKEILKGSIIDSLKDIIKNPRENKTRIIIIEGSCGAGKSTLAKKCKEYYKKQGLLMTLIDESFITQDPEQKLKKYAENLEKFKKNKITKEQMELLAIKWEKEIRDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.22
4 0.22
5 0.29
6 0.3
7 0.35
8 0.39
9 0.44
10 0.52
11 0.61
12 0.69
13 0.7
14 0.75
15 0.75
16 0.81
17 0.84
18 0.82
19 0.76
20 0.7
21 0.62
22 0.55
23 0.5
24 0.45
25 0.43
26 0.37
27 0.37
28 0.4
29 0.39
30 0.41
31 0.47
32 0.43
33 0.37
34 0.36
35 0.34
36 0.28
37 0.3
38 0.28
39 0.19
40 0.18
41 0.17
42 0.18
43 0.18
44 0.22
45 0.2
46 0.2
47 0.24
48 0.27
49 0.31
50 0.35
51 0.35
52 0.35
53 0.35
54 0.37
55 0.37
56 0.35
57 0.35
58 0.34
59 0.36
60 0.37
61 0.38
62 0.37
63 0.37
64 0.37
65 0.32
66 0.34
67 0.28
68 0.21
69 0.19
70 0.18
71 0.15
72 0.14
73 0.14
74 0.14
75 0.2
76 0.27
77 0.3
78 0.37
79 0.41
80 0.43
81 0.45
82 0.43
83 0.4
84 0.34
85 0.34
86 0.27
87 0.23
88 0.23
89 0.19
90 0.16
91 0.13
92 0.12
93 0.09
94 0.07
95 0.06
96 0.09
97 0.15
98 0.21
99 0.25
100 0.27
101 0.31
102 0.37
103 0.47
104 0.52
105 0.54
106 0.59
107 0.66
108 0.7
109 0.69
110 0.66
111 0.57
112 0.51
113 0.42
114 0.33
115 0.23
116 0.17
117 0.14
118 0.11
119 0.1
120 0.08
121 0.08
122 0.09
123 0.08
124 0.15
125 0.17
126 0.25
127 0.27
128 0.28
129 0.33
130 0.35
131 0.4
132 0.41
133 0.48
134 0.51
135 0.58
136 0.63
137 0.67
138 0.72
139 0.68
140 0.7
141 0.71
142 0.68
143 0.69
144 0.71
145 0.73
146 0.71
147 0.77
148 0.75
149 0.67
150 0.64
151 0.55
152 0.45
153 0.43
154 0.37
155 0.29
156 0.26
157 0.27