Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397JBX1

Protein Details
Accession A0A397JBX1    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
54-81DVNNRMSQRARKTRKKGPKPGLSSLKGNHydrophilic
NLS Segment(s)
PositionSequence
62-75RARKTRKKGPKPGL
Subcellular Location(s) nucl 16, cyto_nucl 11.333, cyto_mito 4.666, cyto 4.5, mito 3.5
Family & Domain DBs
Amino Acid Sequences MSILIVSIIEDSSSELRNKIHWQNRIIHLRNYDDDDGDDDDNDNDGYDDCDGDDVNNRMSQRARKTRKKGPKPGLSSLKGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.14
4 0.18
5 0.24
6 0.31
7 0.37
8 0.41
9 0.44
10 0.5
11 0.58
12 0.64
13 0.61
14 0.56
15 0.51
16 0.49
17 0.46
18 0.43
19 0.35
20 0.26
21 0.23
22 0.2
23 0.19
24 0.15
25 0.14
26 0.09
27 0.09
28 0.09
29 0.08
30 0.06
31 0.04
32 0.04
33 0.05
34 0.05
35 0.05
36 0.04
37 0.05
38 0.05
39 0.05
40 0.09
41 0.1
42 0.11
43 0.13
44 0.14
45 0.16
46 0.2
47 0.27
48 0.33
49 0.43
50 0.52
51 0.6
52 0.69
53 0.78
54 0.85
55 0.89
56 0.9
57 0.9
58 0.9
59 0.87
60 0.88
61 0.87