Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397HN80

Protein Details
Accession A0A397HN80    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
109-155GEITSNNKKKKIKKNETGTYKNFRKTFNKKRTHFKTNNKYLNNHPKEHydrophilic
NLS Segment(s)
PositionSequence
116-139KKKKIKKNETGTYKNFRKTFNKKR
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR014876  DEK_C  
Pfam View protein in Pfam  
PF08766  DEK_C  
PROSITE View protein in PROSITE  
PS51998  DEK_C  
Amino Acid Sequences MNIDLSRYILSITKILLNSDLNTVTPRDVRSRLEQNFNIDLTLRKNEVKRIVQLCYDKICEHDNREKKMVEGDEEKKEVLMKEVESEKELKNKCSKRKRDEGDEDGDEGEITSNNKKKKIKKNETGTYKNFRKTFNKKRTHFKTNNKYLNNHPKENKAKTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.2
4 0.19
5 0.19
6 0.2
7 0.19
8 0.16
9 0.17
10 0.17
11 0.16
12 0.17
13 0.19
14 0.21
15 0.24
16 0.27
17 0.34
18 0.42
19 0.45
20 0.5
21 0.5
22 0.51
23 0.5
24 0.46
25 0.39
26 0.3
27 0.27
28 0.22
29 0.23
30 0.2
31 0.21
32 0.22
33 0.27
34 0.34
35 0.36
36 0.4
37 0.4
38 0.4
39 0.41
40 0.42
41 0.39
42 0.35
43 0.33
44 0.26
45 0.25
46 0.27
47 0.24
48 0.27
49 0.35
50 0.38
51 0.4
52 0.44
53 0.42
54 0.38
55 0.4
56 0.35
57 0.28
58 0.28
59 0.28
60 0.27
61 0.28
62 0.27
63 0.23
64 0.23
65 0.19
66 0.15
67 0.12
68 0.09
69 0.11
70 0.13
71 0.13
72 0.13
73 0.15
74 0.15
75 0.21
76 0.22
77 0.23
78 0.31
79 0.38
80 0.47
81 0.55
82 0.64
83 0.65
84 0.74
85 0.76
86 0.77
87 0.78
88 0.73
89 0.69
90 0.61
91 0.53
92 0.43
93 0.36
94 0.26
95 0.18
96 0.13
97 0.07
98 0.07
99 0.13
100 0.18
101 0.21
102 0.28
103 0.36
104 0.45
105 0.55
106 0.65
107 0.7
108 0.76
109 0.83
110 0.86
111 0.89
112 0.88
113 0.84
114 0.83
115 0.79
116 0.76
117 0.69
118 0.66
119 0.66
120 0.68
121 0.72
122 0.73
123 0.77
124 0.75
125 0.83
126 0.86
127 0.87
128 0.86
129 0.86
130 0.87
131 0.87
132 0.9
133 0.84
134 0.79
135 0.79
136 0.8
137 0.77
138 0.75
139 0.69
140 0.69
141 0.74