Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397HHE7

Protein Details
Accession A0A397HHE7    Localization Confidence High Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
17-43ECKLCNKIYKRPSGLKKHKKIIKDLNTHydrophilic
181-205QLNIQKSRNSLKKKIYRPKPVQIIIHydrophilic
NLS Segment(s)
PositionSequence
29-36SGLKKHKK
193-194KK
Subcellular Location(s) nucl 14, mito 11
Family & Domain DBs
Amino Acid Sequences MTDFKTKNKTLPCKTLECKLCNKIYKRPSGLKKHKKIIKDLNTIKPSIYILPEKAIEETCQMLVYHIKEKLKQNSRHVGNVSVTIGGTESQFFGVFKGYIHNYFPKSGTYKCIFKGADAYSTLAHILKDENWGVKYFLQHQKTFVLLNSNNQNSLQESYLNKENQEPDPLQELDPLQEPDQLNIQKSRNSLKKKIYRPKPVQIIIGWKKKIKSDVYNITSSAGFIFINFIVSRTKVYNSVYVDIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.73
3 0.71
4 0.66
5 0.66
6 0.64
7 0.67
8 0.67
9 0.69
10 0.69
11 0.7
12 0.74
13 0.73
14 0.75
15 0.77
16 0.79
17 0.85
18 0.86
19 0.87
20 0.87
21 0.85
22 0.81
23 0.81
24 0.81
25 0.79
26 0.79
27 0.77
28 0.77
29 0.75
30 0.7
31 0.6
32 0.5
33 0.41
34 0.33
35 0.28
36 0.22
37 0.19
38 0.22
39 0.22
40 0.22
41 0.22
42 0.21
43 0.17
44 0.15
45 0.16
46 0.13
47 0.13
48 0.12
49 0.11
50 0.14
51 0.15
52 0.19
53 0.22
54 0.24
55 0.28
56 0.36
57 0.45
58 0.51
59 0.56
60 0.6
61 0.65
62 0.66
63 0.66
64 0.6
65 0.54
66 0.45
67 0.39
68 0.32
69 0.22
70 0.18
71 0.13
72 0.12
73 0.08
74 0.07
75 0.06
76 0.05
77 0.05
78 0.06
79 0.06
80 0.06
81 0.07
82 0.07
83 0.06
84 0.09
85 0.1
86 0.12
87 0.14
88 0.17
89 0.18
90 0.19
91 0.2
92 0.19
93 0.21
94 0.2
95 0.24
96 0.24
97 0.25
98 0.24
99 0.3
100 0.27
101 0.24
102 0.29
103 0.24
104 0.22
105 0.2
106 0.2
107 0.14
108 0.14
109 0.14
110 0.09
111 0.08
112 0.06
113 0.06
114 0.06
115 0.08
116 0.09
117 0.1
118 0.1
119 0.11
120 0.12
121 0.12
122 0.13
123 0.19
124 0.26
125 0.29
126 0.28
127 0.29
128 0.29
129 0.29
130 0.28
131 0.22
132 0.21
133 0.17
134 0.22
135 0.27
136 0.26
137 0.26
138 0.25
139 0.25
140 0.2
141 0.21
142 0.16
143 0.14
144 0.14
145 0.17
146 0.23
147 0.23
148 0.22
149 0.24
150 0.26
151 0.25
152 0.29
153 0.26
154 0.21
155 0.26
156 0.26
157 0.23
158 0.22
159 0.2
160 0.17
161 0.19
162 0.19
163 0.14
164 0.19
165 0.18
166 0.17
167 0.24
168 0.24
169 0.24
170 0.27
171 0.29
172 0.27
173 0.3
174 0.38
175 0.4
176 0.46
177 0.52
178 0.57
179 0.65
180 0.72
181 0.8
182 0.82
183 0.84
184 0.85
185 0.86
186 0.85
187 0.79
188 0.73
189 0.65
190 0.65
191 0.63
192 0.64
193 0.58
194 0.53
195 0.52
196 0.52
197 0.57
198 0.53
199 0.52
200 0.53
201 0.59
202 0.6
203 0.6
204 0.56
205 0.51
206 0.43
207 0.35
208 0.25
209 0.16
210 0.11
211 0.08
212 0.1
213 0.08
214 0.11
215 0.11
216 0.12
217 0.13
218 0.14
219 0.17
220 0.17
221 0.2
222 0.22
223 0.25
224 0.3
225 0.32