Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397GIA9

Protein Details
Accession A0A397GIA9    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
17-73KEYIKERKEKSELKKKERKFKKELKENKKKLFEEIKEERLKRNENKREKVREKHVTWBasic
NLS Segment(s)
PositionSequence
20-69IKERKEKSELKKKERKFKKELKENKKKLFEEIKEERLKRNENKREKVREK
Subcellular Location(s) nucl 16.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MLSNVKQSARLISNKVKEYIKERKEKSELKKKERKFKKELKENKKKLFEEIKEERLKRNENKREKVREKHVTWGKNEVFII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.51
3 0.47
4 0.45
5 0.48
6 0.52
7 0.52
8 0.55
9 0.54
10 0.58
11 0.64
12 0.69
13 0.71
14 0.72
15 0.73
16 0.74
17 0.8
18 0.79
19 0.82
20 0.84
21 0.82
22 0.81
23 0.81
24 0.81
25 0.82
26 0.86
27 0.86
28 0.87
29 0.87
30 0.86
31 0.85
32 0.75
33 0.71
34 0.7
35 0.61
36 0.59
37 0.56
38 0.56
39 0.55
40 0.56
41 0.54
42 0.51
43 0.57
44 0.56
45 0.62
46 0.64
47 0.67
48 0.76
49 0.8
50 0.84
51 0.86
52 0.87
53 0.86
54 0.86
55 0.78
56 0.79
57 0.78
58 0.73
59 0.67
60 0.68
61 0.59