Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397J7T8

Protein Details
Accession A0A397J7T8    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
123-150GCYRTFRSFVRKRRWVKLRRLKGSSNEDHydrophilic
NLS Segment(s)
PositionSequence
133-144RKRRWVKLRRLK
Subcellular Location(s) nucl 21, cyto_nucl 11.833, mito_nucl 11.833, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010482  Peroxin  
IPR006614  Peroxin/Ferlin  
Gene Ontology GO:0005778  C:peroxisomal membrane  
GO:0007031  P:peroxisome organization  
Pfam View protein in Pfam  
PF06398  Pex24p  
Amino Acid Sequences MFIMDNENSESFNTIKIIRQYEASDVQSNNNAPSYKYDILYENQRGLFVMGIPKFNSKVLSPADPPPWTNIDQECSPMDIHTFQLPDPSWEWVYKEWLIDMSGDVDEEGWEYAFDFHCDNWHGCYRTFRSFVRKRRWVKLRRLKGSSNEDIPPIPSRVKKDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.18
3 0.23
4 0.27
5 0.25
6 0.28
7 0.28
8 0.31
9 0.34
10 0.33
11 0.32
12 0.29
13 0.3
14 0.32
15 0.31
16 0.28
17 0.26
18 0.23
19 0.19
20 0.23
21 0.28
22 0.26
23 0.26
24 0.26
25 0.25
26 0.27
27 0.34
28 0.32
29 0.28
30 0.26
31 0.25
32 0.24
33 0.22
34 0.19
35 0.12
36 0.16
37 0.13
38 0.15
39 0.16
40 0.17
41 0.18
42 0.18
43 0.19
44 0.13
45 0.17
46 0.17
47 0.2
48 0.21
49 0.24
50 0.27
51 0.27
52 0.27
53 0.25
54 0.25
55 0.23
56 0.23
57 0.2
58 0.19
59 0.18
60 0.2
61 0.17
62 0.16
63 0.14
64 0.12
65 0.12
66 0.09
67 0.1
68 0.09
69 0.09
70 0.08
71 0.11
72 0.11
73 0.12
74 0.12
75 0.14
76 0.14
77 0.14
78 0.15
79 0.13
80 0.17
81 0.15
82 0.15
83 0.12
84 0.12
85 0.12
86 0.1
87 0.1
88 0.07
89 0.06
90 0.06
91 0.06
92 0.05
93 0.05
94 0.05
95 0.05
96 0.04
97 0.04
98 0.04
99 0.06
100 0.06
101 0.07
102 0.08
103 0.08
104 0.1
105 0.13
106 0.13
107 0.16
108 0.23
109 0.24
110 0.24
111 0.32
112 0.35
113 0.39
114 0.42
115 0.41
116 0.45
117 0.53
118 0.61
119 0.65
120 0.69
121 0.7
122 0.77
123 0.84
124 0.83
125 0.85
126 0.86
127 0.86
128 0.86
129 0.86
130 0.82
131 0.8
132 0.8
133 0.75
134 0.69
135 0.6
136 0.52
137 0.46
138 0.43
139 0.37
140 0.32
141 0.31
142 0.31