Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397GBQ4

Protein Details
Accession A0A397GBQ4    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSTRRKLRASKNPPRPPNSYFHydrophilic
74-100NELYSQYKFRPRKRKTFKMHVFPHECTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 14, nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MSTRRKLRASKNPPRPPNSYFLMKNCYMLELRAIDLRYTMPELCIQSKQLWKEAPKEAKDRYDELQSKAQSIHNELYSQYKFRPRKRKTFKMHVFPHECTANITTFSSTNYLKRPTSQLDNYSPAESEXDME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.83
3 0.75
4 0.7
5 0.65
6 0.61
7 0.55
8 0.5
9 0.51
10 0.45
11 0.43
12 0.37
13 0.34
14 0.27
15 0.23
16 0.21
17 0.16
18 0.16
19 0.17
20 0.17
21 0.14
22 0.14
23 0.15
24 0.13
25 0.14
26 0.13
27 0.11
28 0.13
29 0.15
30 0.17
31 0.18
32 0.18
33 0.2
34 0.24
35 0.25
36 0.26
37 0.28
38 0.28
39 0.33
40 0.39
41 0.42
42 0.42
43 0.45
44 0.44
45 0.44
46 0.44
47 0.41
48 0.35
49 0.37
50 0.36
51 0.34
52 0.37
53 0.32
54 0.3
55 0.29
56 0.3
57 0.22
58 0.22
59 0.21
60 0.16
61 0.17
62 0.16
63 0.2
64 0.19
65 0.2
66 0.19
67 0.27
68 0.33
69 0.42
70 0.53
71 0.54
72 0.65
73 0.74
74 0.81
75 0.81
76 0.85
77 0.85
78 0.85
79 0.86
80 0.85
81 0.8
82 0.72
83 0.67
84 0.57
85 0.48
86 0.4
87 0.33
88 0.25
89 0.2
90 0.19
91 0.16
92 0.15
93 0.16
94 0.17
95 0.17
96 0.2
97 0.23
98 0.28
99 0.28
100 0.31
101 0.36
102 0.38
103 0.45
104 0.48
105 0.49
106 0.5
107 0.54
108 0.53
109 0.49
110 0.43
111 0.35