Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IK90

Protein Details
Accession A0A397IK90    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
70-91SSSVKRKRNSGGDARNKRARRKBasic
NLS Segment(s)
PositionSequence
74-91KRKRNSGGDARNKRARRK
Subcellular Location(s) nucl 24, cyto_nucl 15.5
Family & Domain DBs
Amino Acid Sequences MKLIDQCENPENKKQLRSILMEIDFIHLHFNESEGELLEIAKELLRPYRNKYMRALTIFVPKQVPETSSSSSVKRKRNSGGDARNKRARRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.51
3 0.5
4 0.51
5 0.46
6 0.45
7 0.41
8 0.37
9 0.34
10 0.3
11 0.24
12 0.2
13 0.18
14 0.11
15 0.11
16 0.1
17 0.1
18 0.08
19 0.09
20 0.09
21 0.08
22 0.08
23 0.06
24 0.06
25 0.05
26 0.05
27 0.04
28 0.04
29 0.04
30 0.05
31 0.09
32 0.13
33 0.15
34 0.2
35 0.3
36 0.34
37 0.35
38 0.39
39 0.41
40 0.42
41 0.43
42 0.4
43 0.32
44 0.37
45 0.36
46 0.33
47 0.29
48 0.23
49 0.24
50 0.23
51 0.22
52 0.16
53 0.21
54 0.22
55 0.26
56 0.28
57 0.29
58 0.38
59 0.45
60 0.49
61 0.51
62 0.55
63 0.58
64 0.64
65 0.68
66 0.7
67 0.73
68 0.76
69 0.8
70 0.81
71 0.83