Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397IZV3

Protein Details
Accession A0A397IZV3    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
19-47IKYNGNSIRTKKRKKAKAKKMAAKNGRTIHydrophilic
NLS Segment(s)
PositionSequence
28-44RTKKRKKAKAKKMAAKN
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MGKKFQFQCVENISKYIAXIKYNGNSIRTKKRKKAKAKKMAAKNGRTIDQLFLPTSQTNETSETNLHNDENSETDNDNNNNQLETSDMEIDVDKLIHLTKSKLQDKTLPPNQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.29
4 0.26
5 0.22
6 0.25
7 0.25
8 0.34
9 0.35
10 0.37
11 0.38
12 0.4
13 0.49
14 0.56
15 0.64
16 0.63
17 0.7
18 0.77
19 0.84
20 0.89
21 0.89
22 0.89
23 0.91
24 0.91
25 0.91
26 0.91
27 0.88
28 0.81
29 0.77
30 0.69
31 0.6
32 0.52
33 0.43
34 0.34
35 0.26
36 0.23
37 0.17
38 0.14
39 0.14
40 0.12
41 0.12
42 0.11
43 0.11
44 0.1
45 0.13
46 0.13
47 0.12
48 0.13
49 0.13
50 0.14
51 0.15
52 0.14
53 0.11
54 0.11
55 0.11
56 0.11
57 0.11
58 0.11
59 0.1
60 0.12
61 0.16
62 0.17
63 0.17
64 0.18
65 0.18
66 0.16
67 0.16
68 0.14
69 0.11
70 0.11
71 0.12
72 0.11
73 0.1
74 0.1
75 0.11
76 0.11
77 0.1
78 0.09
79 0.06
80 0.06
81 0.07
82 0.09
83 0.11
84 0.13
85 0.19
86 0.29
87 0.37
88 0.4
89 0.43
90 0.49
91 0.56
92 0.64