Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397JPI8

Protein Details
Accession A0A397JPI8    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-44ISEVRFKKRRSEESEVPKKRIIIKRSKEVQKRINEKKRSAHydrophilic
NLS Segment(s)
PositionSequence
10-44FKKRRSEESEVPKKRIIIKRSKEVQKRINEKKRSA
77-97KKRKREKGKGVGEGEKIKETK
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MPPPISEVRFKKRRSEESEVPKKRIIIKRSKEVQKRINEKKRSAVEKANKILWPLFNSRQNKMTFDMPPPISEVLIKKRKREKGKGVGEGEKIKETKEKVLGKVDEILRPLIEAMEVMKAVEMKIPQISAVPIKKRKWEERN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.76
3 0.75
4 0.78
5 0.86
6 0.82
7 0.77
8 0.7
9 0.64
10 0.64
11 0.62
12 0.6
13 0.6
14 0.61
15 0.67
16 0.74
17 0.8
18 0.8
19 0.81
20 0.8
21 0.79
22 0.82
23 0.83
24 0.83
25 0.81
26 0.76
27 0.76
28 0.75
29 0.71
30 0.65
31 0.64
32 0.63
33 0.63
34 0.63
35 0.59
36 0.51
37 0.47
38 0.44
39 0.36
40 0.31
41 0.28
42 0.3
43 0.33
44 0.36
45 0.37
46 0.4
47 0.39
48 0.37
49 0.34
50 0.33
51 0.27
52 0.26
53 0.3
54 0.24
55 0.23
56 0.23
57 0.21
58 0.17
59 0.16
60 0.16
61 0.19
62 0.28
63 0.3
64 0.35
65 0.44
66 0.52
67 0.6
68 0.67
69 0.68
70 0.7
71 0.77
72 0.78
73 0.74
74 0.7
75 0.64
76 0.58
77 0.49
78 0.42
79 0.33
80 0.26
81 0.26
82 0.23
83 0.25
84 0.3
85 0.33
86 0.32
87 0.4
88 0.4
89 0.37
90 0.42
91 0.39
92 0.33
93 0.3
94 0.27
95 0.19
96 0.19
97 0.17
98 0.11
99 0.09
100 0.06
101 0.06
102 0.07
103 0.07
104 0.06
105 0.07
106 0.07
107 0.07
108 0.1
109 0.1
110 0.1
111 0.12
112 0.12
113 0.12
114 0.13
115 0.15
116 0.2
117 0.27
118 0.35
119 0.42
120 0.46
121 0.55
122 0.63