Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397J0A0

Protein Details
Accession A0A397J0A0    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LYFEYRKIKKEWKKLHEEKKRKWREDYBasic
NLS Segment(s)
PositionSequence
20-60RKIKKEWKKLHEEKKRKWREDYESRKLEIEAEMKFKKKLKK
Subcellular Location(s) nucl 13, mito 12, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MNSAILYQIPRKIKLYFEYRKIKKEWKKLHEEKKRKWREDYESRKLEIEAEMKFKKKLKKEVAFREGGREDFVVYEVRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.44
3 0.45
4 0.51
5 0.58
6 0.6
7 0.64
8 0.65
9 0.69
10 0.68
11 0.71
12 0.72
13 0.7
14 0.76
15 0.8
16 0.86
17 0.86
18 0.87
19 0.86
20 0.87
21 0.89
22 0.82
23 0.79
24 0.76
25 0.74
26 0.75
27 0.74
28 0.73
29 0.66
30 0.63
31 0.57
32 0.49
33 0.41
34 0.33
35 0.26
36 0.18
37 0.21
38 0.23
39 0.24
40 0.27
41 0.32
42 0.37
43 0.42
44 0.5
45 0.55
46 0.62
47 0.7
48 0.77
49 0.79
50 0.78
51 0.71
52 0.69
53 0.61
54 0.52
55 0.44
56 0.34
57 0.27
58 0.21
59 0.22