Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397JGT6

Protein Details
Accession A0A397JGT6    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
62-88EWGYPAFAKRPQRRGHKKNFSNEPVKLHydrophilic
NLS Segment(s)
PositionSequence
74-75RR
Subcellular Location(s) nucl 11.5, cyto_nucl 9.5, cyto 6.5, cysk 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR043129  ATPase_NBD  
Amino Acid Sequences MSWRSDIKVVVAIEFGAKYSGFAYVHRSNPELVTNDRWPEQIGPLKTNTVLQYDEKYENVLEWGYPAFAKRPQRRGHKKNFSNEPVKLFNLHLSSMPDSEKPPLPKSLHYKKAITDYLREIEYPIRSLRILRECVYNAELIRYFTSEKLQFITELEAASMHCVQVLREYFGTSKESFLIANCGDDTVDLITRKFRFTDVLGEVTKQTGDSCCFNYVEKEFIKLLKHYMGDEAMKILEHSDQMQYVMKEFFKVTFSFSGNPQDFKLYEFDLEEVCPIIKSYVTGSYKEKLEKAEWTIELDFKTIKSLFDPAIERIIRLISGHLNKGDKYDILFLIGDFSESRYLVKRIREEFADKMKGIVVPKQPKGVIVRGAAEYASQMFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.1
4 0.09
5 0.09
6 0.09
7 0.13
8 0.12
9 0.13
10 0.2
11 0.26
12 0.31
13 0.33
14 0.34
15 0.32
16 0.34
17 0.38
18 0.33
19 0.31
20 0.33
21 0.35
22 0.37
23 0.37
24 0.35
25 0.32
26 0.31
27 0.34
28 0.35
29 0.33
30 0.33
31 0.34
32 0.36
33 0.34
34 0.36
35 0.31
36 0.25
37 0.25
38 0.23
39 0.25
40 0.28
41 0.29
42 0.26
43 0.26
44 0.23
45 0.21
46 0.2
47 0.16
48 0.11
49 0.1
50 0.1
51 0.09
52 0.09
53 0.1
54 0.12
55 0.18
56 0.28
57 0.36
58 0.45
59 0.53
60 0.64
61 0.74
62 0.82
63 0.87
64 0.88
65 0.87
66 0.88
67 0.9
68 0.87
69 0.84
70 0.77
71 0.71
72 0.64
73 0.57
74 0.49
75 0.39
76 0.35
77 0.28
78 0.25
79 0.21
80 0.21
81 0.21
82 0.21
83 0.21
84 0.19
85 0.18
86 0.22
87 0.25
88 0.26
89 0.27
90 0.33
91 0.34
92 0.39
93 0.47
94 0.54
95 0.57
96 0.58
97 0.57
98 0.53
99 0.58
100 0.57
101 0.49
102 0.43
103 0.38
104 0.36
105 0.34
106 0.31
107 0.25
108 0.23
109 0.22
110 0.2
111 0.17
112 0.16
113 0.15
114 0.17
115 0.22
116 0.24
117 0.26
118 0.26
119 0.29
120 0.29
121 0.31
122 0.3
123 0.26
124 0.19
125 0.19
126 0.18
127 0.15
128 0.15
129 0.14
130 0.14
131 0.13
132 0.18
133 0.16
134 0.16
135 0.16
136 0.16
137 0.15
138 0.15
139 0.16
140 0.12
141 0.1
142 0.1
143 0.08
144 0.08
145 0.09
146 0.09
147 0.06
148 0.06
149 0.06
150 0.06
151 0.11
152 0.12
153 0.12
154 0.12
155 0.14
156 0.13
157 0.15
158 0.18
159 0.14
160 0.13
161 0.12
162 0.12
163 0.11
164 0.11
165 0.13
166 0.09
167 0.1
168 0.09
169 0.08
170 0.07
171 0.07
172 0.07
173 0.05
174 0.07
175 0.06
176 0.07
177 0.11
178 0.12
179 0.12
180 0.12
181 0.12
182 0.12
183 0.13
184 0.19
185 0.17
186 0.2
187 0.19
188 0.19
189 0.19
190 0.17
191 0.16
192 0.1
193 0.09
194 0.07
195 0.08
196 0.1
197 0.11
198 0.13
199 0.14
200 0.14
201 0.16
202 0.15
203 0.18
204 0.16
205 0.17
206 0.16
207 0.18
208 0.2
209 0.18
210 0.19
211 0.18
212 0.18
213 0.16
214 0.17
215 0.16
216 0.15
217 0.14
218 0.13
219 0.09
220 0.09
221 0.08
222 0.08
223 0.06
224 0.06
225 0.07
226 0.08
227 0.08
228 0.09
229 0.12
230 0.11
231 0.12
232 0.14
233 0.13
234 0.13
235 0.13
236 0.13
237 0.13
238 0.13
239 0.15
240 0.16
241 0.18
242 0.18
243 0.2
244 0.27
245 0.26
246 0.27
247 0.25
248 0.24
249 0.23
250 0.23
251 0.23
252 0.15
253 0.15
254 0.14
255 0.14
256 0.12
257 0.12
258 0.11
259 0.09
260 0.08
261 0.07
262 0.07
263 0.07
264 0.06
265 0.06
266 0.08
267 0.16
268 0.18
269 0.21
270 0.24
271 0.27
272 0.31
273 0.33
274 0.33
275 0.29
276 0.29
277 0.31
278 0.32
279 0.33
280 0.3
281 0.31
282 0.31
283 0.29
284 0.27
285 0.24
286 0.21
287 0.15
288 0.19
289 0.16
290 0.15
291 0.14
292 0.17
293 0.17
294 0.21
295 0.23
296 0.2
297 0.27
298 0.27
299 0.25
300 0.23
301 0.23
302 0.19
303 0.16
304 0.17
305 0.17
306 0.2
307 0.23
308 0.27
309 0.29
310 0.29
311 0.31
312 0.31
313 0.24
314 0.23
315 0.24
316 0.2
317 0.2
318 0.19
319 0.17
320 0.17
321 0.16
322 0.15
323 0.11
324 0.12
325 0.12
326 0.12
327 0.14
328 0.16
329 0.2
330 0.24
331 0.31
332 0.38
333 0.4
334 0.44
335 0.47
336 0.48
337 0.52
338 0.56
339 0.55
340 0.47
341 0.44
342 0.41
343 0.39
344 0.37
345 0.37
346 0.38
347 0.41
348 0.44
349 0.49
350 0.48
351 0.49
352 0.52
353 0.51
354 0.47
355 0.41
356 0.41
357 0.36
358 0.36
359 0.31
360 0.26
361 0.21