Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397H5E3

Protein Details
Accession A0A397H5E3    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-35VKTSSSGGKTKKKKWSKGKVKEKANNAVVHydrophilic
NLS Segment(s)
PositionSequence
12-29SGGKTKKKKWSKGKVKEK
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKEKAVKTSSSGGKTKKKKWSKGKVKEKANNAVVLEKATYDKLFKDVPSYKLITPSVLVDRLHVNGSLARVAIRELEAKGLIRKISSHGSQLIYTRATAAIDIPEEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.65
3 0.7
4 0.72
5 0.75
6 0.79
7 0.84
8 0.87
9 0.89
10 0.91
11 0.93
12 0.92
13 0.92
14 0.89
15 0.85
16 0.83
17 0.75
18 0.67
19 0.56
20 0.49
21 0.38
22 0.32
23 0.24
24 0.15
25 0.13
26 0.11
27 0.11
28 0.09
29 0.09
30 0.11
31 0.12
32 0.12
33 0.18
34 0.21
35 0.23
36 0.26
37 0.28
38 0.25
39 0.28
40 0.28
41 0.21
42 0.18
43 0.17
44 0.15
45 0.15
46 0.14
47 0.11
48 0.12
49 0.13
50 0.13
51 0.12
52 0.11
53 0.09
54 0.1
55 0.1
56 0.08
57 0.08
58 0.07
59 0.07
60 0.08
61 0.08
62 0.09
63 0.09
64 0.1
65 0.11
66 0.12
67 0.14
68 0.16
69 0.15
70 0.14
71 0.15
72 0.17
73 0.22
74 0.23
75 0.24
76 0.25
77 0.27
78 0.28
79 0.29
80 0.29
81 0.24
82 0.22
83 0.2
84 0.17
85 0.15
86 0.13
87 0.12
88 0.11