Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397IRF0

Protein Details
Accession A0A397IRF0    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
72-96HKTGAVKRCPIRKRKVKGKVNYRALBasic
NLS Segment(s)
PositionSequence
82-90IRKRKVKGK
Subcellular Location(s) nucl 14, cyto_nucl 11, mito 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MQVNKHQQPLYIIPRLILQELYRVGISVNKRDIRDFSATSDSGAFDSDTSSNSDTSDSSALSGSGIEVTHAHKTGAVKRCPIRKRKVKGKVNYRAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.32
4 0.26
5 0.19
6 0.17
7 0.18
8 0.19
9 0.16
10 0.14
11 0.13
12 0.16
13 0.18
14 0.19
15 0.26
16 0.28
17 0.29
18 0.31
19 0.33
20 0.33
21 0.35
22 0.3
23 0.26
24 0.26
25 0.26
26 0.24
27 0.23
28 0.18
29 0.14
30 0.13
31 0.1
32 0.06
33 0.07
34 0.06
35 0.07
36 0.08
37 0.09
38 0.08
39 0.09
40 0.09
41 0.08
42 0.09
43 0.09
44 0.08
45 0.07
46 0.07
47 0.07
48 0.07
49 0.06
50 0.05
51 0.05
52 0.05
53 0.05
54 0.06
55 0.08
56 0.1
57 0.11
58 0.11
59 0.12
60 0.16
61 0.24
62 0.32
63 0.33
64 0.38
65 0.45
66 0.54
67 0.61
68 0.68
69 0.71
70 0.72
71 0.79
72 0.83
73 0.87
74 0.88
75 0.9
76 0.91