Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397J8W9

Protein Details
Accession A0A397J8W9    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
12-40RNRKSIKSISRTPKKLKKRELSLKHHLSNHydrophilic
NLS Segment(s)
PositionSequence
12-31RNRKSIKSISRTPKKLKKRE
Subcellular Location(s) nucl 13, mito 7, cyto_nucl 7
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNNIRDIKEMIRNRKSIKSISRTPKKLKKRELSLKHHLSNSIDSITILLLLYQTVIIIIIIIKQLIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.62
3 0.59
4 0.6
5 0.58
6 0.6
7 0.66
8 0.72
9 0.72
10 0.78
11 0.8
12 0.81
13 0.83
14 0.83
15 0.81
16 0.82
17 0.85
18 0.85
19 0.84
20 0.83
21 0.8
22 0.73
23 0.65
24 0.57
25 0.48
26 0.4
27 0.33
28 0.24
29 0.17
30 0.13
31 0.12
32 0.1
33 0.09
34 0.07
35 0.05
36 0.04
37 0.04
38 0.04
39 0.04
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.04
46 0.05
47 0.05