Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IIU5

Protein Details
Accession A0A397IIU5    Localization Confidence High Confidence Score 18.9
NoLS Segment(s)
PositionSequenceProtein Nature
3-29KLSRKTIRGSTRRTYKNNNKIDKKEAPHydrophilic
88-109RKTIRGSTRRTHKNDNKIDKKEBasic
NLS Segment(s)
PositionSequence
73-99RRNRQKATRTIIKSSRKTIRGSTRRTH
Subcellular Location(s) nucl 24, mito 3
Family & Domain DBs
Amino Acid Sequences MMKLSRKTIRGSTRRTYKNNNKIDKKEAPQERWNRKETTRTVMKLLKKIIRGCTTRTMMKLTRVHKNAPQESRRNRQKATRTIIKSSRKTIRGSTRRTHKNDNKIDKKEVLQEPPQELPQELPQELPQEPLQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.79
3 0.81
4 0.81
5 0.82
6 0.85
7 0.85
8 0.84
9 0.81
10 0.82
11 0.8
12 0.74
13 0.74
14 0.72
15 0.69
16 0.69
17 0.73
18 0.75
19 0.73
20 0.72
21 0.67
22 0.62
23 0.64
24 0.58
25 0.56
26 0.54
27 0.49
28 0.5
29 0.52
30 0.53
31 0.49
32 0.52
33 0.47
34 0.45
35 0.47
36 0.48
37 0.48
38 0.46
39 0.44
40 0.45
41 0.44
42 0.41
43 0.38
44 0.36
45 0.31
46 0.36
47 0.39
48 0.35
49 0.4
50 0.4
51 0.41
52 0.4
53 0.47
54 0.46
55 0.47
56 0.5
57 0.51
58 0.55
59 0.63
60 0.69
61 0.66
62 0.62
63 0.62
64 0.65
65 0.65
66 0.66
67 0.65
68 0.6
69 0.62
70 0.68
71 0.69
72 0.64
73 0.63
74 0.63
75 0.57
76 0.56
77 0.57
78 0.59
79 0.59
80 0.62
81 0.63
82 0.65
83 0.71
84 0.75
85 0.78
86 0.76
87 0.78
88 0.81
89 0.84
90 0.83
91 0.79
92 0.79
93 0.71
94 0.66
95 0.64
96 0.6
97 0.55
98 0.51
99 0.5
100 0.49
101 0.48
102 0.47
103 0.39
104 0.34
105 0.31
106 0.3
107 0.31
108 0.27
109 0.26
110 0.26
111 0.28
112 0.28
113 0.29