Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IQB7

Protein Details
Accession A0A397IQB7    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
89-128RLVRHKLQESKKTARKQRKERKNRAKRFRGTKKAKASATABasic
NLS Segment(s)
PositionSequence
85-130EPKFRLVRHKLQESKKTARKQRKERKNRAKRFRGTKKAKASATAKK
Subcellular Location(s) mito 18, cyto_nucl 5, nucl 4.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MDTATIRTRKFLTNRLLKRKQMVVDVIHPGLANLSKDDVRGKLAKLYKVEKEVIFVFGFHTYFGGGRSTGFALIYDDLETAKKFEPKFRLVRHKLQESKKTARKQRKERKNRAKRFRGTKKAKASATAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.71
3 0.77
4 0.74
5 0.74
6 0.72
7 0.66
8 0.61
9 0.55
10 0.49
11 0.45
12 0.45
13 0.39
14 0.33
15 0.29
16 0.23
17 0.19
18 0.17
19 0.13
20 0.09
21 0.11
22 0.11
23 0.12
24 0.14
25 0.14
26 0.16
27 0.17
28 0.17
29 0.22
30 0.26
31 0.29
32 0.31
33 0.34
34 0.34
35 0.36
36 0.38
37 0.31
38 0.29
39 0.26
40 0.24
41 0.2
42 0.17
43 0.14
44 0.12
45 0.12
46 0.09
47 0.08
48 0.06
49 0.06
50 0.07
51 0.06
52 0.05
53 0.05
54 0.06
55 0.07
56 0.07
57 0.06
58 0.06
59 0.06
60 0.07
61 0.07
62 0.06
63 0.06
64 0.06
65 0.07
66 0.07
67 0.08
68 0.1
69 0.14
70 0.14
71 0.2
72 0.26
73 0.32
74 0.4
75 0.47
76 0.56
77 0.58
78 0.67
79 0.69
80 0.73
81 0.75
82 0.75
83 0.76
84 0.73
85 0.77
86 0.76
87 0.78
88 0.78
89 0.8
90 0.82
91 0.85
92 0.88
93 0.89
94 0.92
95 0.94
96 0.95
97 0.95
98 0.96
99 0.96
100 0.95
101 0.94
102 0.94
103 0.93
104 0.93
105 0.92
106 0.91
107 0.9
108 0.89
109 0.81
110 0.79