Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IWV6

Protein Details
Accession A0A397IWV6    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
83-103QKNIATKYPKPQRINIKKLKRHydrophilic
NLS Segment(s)
PositionSequence
98-103IKKLKR
Subcellular Location(s) nucl 18, cyto_nucl 11.833, mito_nucl 11.333, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MGLYRPTDVTPYMHILVNHLSEFMERHRFSLSDFSCSPVEKKNHDQVSAFFRKTMKDGGKKLERKSAIFEILDYENRALYFSQKNIATKYPKPQRINIKKLKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.24
4 0.24
5 0.21
6 0.16
7 0.14
8 0.13
9 0.14
10 0.16
11 0.22
12 0.2
13 0.21
14 0.22
15 0.22
16 0.23
17 0.32
18 0.29
19 0.25
20 0.25
21 0.27
22 0.26
23 0.27
24 0.27
25 0.25
26 0.28
27 0.27
28 0.33
29 0.39
30 0.4
31 0.41
32 0.4
33 0.35
34 0.4
35 0.41
36 0.35
37 0.28
38 0.25
39 0.25
40 0.25
41 0.29
42 0.27
43 0.29
44 0.31
45 0.38
46 0.47
47 0.52
48 0.53
49 0.54
50 0.5
51 0.44
52 0.47
53 0.43
54 0.37
55 0.32
56 0.29
57 0.24
58 0.24
59 0.24
60 0.2
61 0.16
62 0.13
63 0.13
64 0.14
65 0.11
66 0.14
67 0.16
68 0.16
69 0.22
70 0.24
71 0.27
72 0.29
73 0.36
74 0.38
75 0.4
76 0.49
77 0.54
78 0.61
79 0.63
80 0.68
81 0.73
82 0.77
83 0.83