Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397ITJ8

Protein Details
Accession A0A397ITJ8    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-24TDPEYLRNPKNYKRNKLSDIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, cyto_nucl 9.5, cyto 8.5, mito 5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR000719  Prot_kinase_dom  
IPR001245  Ser-Thr/Tyr_kinase_cat_dom  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004672  F:protein kinase activity  
GO:0006468  P:protein phosphorylation  
Pfam View protein in Pfam  
PF07714  PK_Tyr_Ser-Thr  
PROSITE View protein in PROSITE  
PS50011  PROTEIN_KINASE_DOM  
Amino Acid Sequences MIAYTDPEYLRNPKNYKRNKLSDIYSLRILFWELSSGRPPFNTXNFYGINPKKGTHYLVLQHARDGDLRTYLRNNFKILDWKIKINMAKDITSGLHCIHDENIVHKDLHSKNILVHEGRLLITDLGLSQPLDAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.69
3 0.75
4 0.78
5 0.8
6 0.78
7 0.77
8 0.73
9 0.72
10 0.67
11 0.6
12 0.55
13 0.46
14 0.4
15 0.34
16 0.31
17 0.21
18 0.16
19 0.16
20 0.11
21 0.13
22 0.17
23 0.18
24 0.17
25 0.18
26 0.2
27 0.18
28 0.23
29 0.22
30 0.2
31 0.21
32 0.22
33 0.32
34 0.3
35 0.35
36 0.32
37 0.31
38 0.31
39 0.31
40 0.31
41 0.23
42 0.26
43 0.22
44 0.29
45 0.33
46 0.3
47 0.29
48 0.27
49 0.25
50 0.23
51 0.21
52 0.13
53 0.12
54 0.12
55 0.13
56 0.16
57 0.19
58 0.24
59 0.24
60 0.25
61 0.23
62 0.23
63 0.31
64 0.3
65 0.35
66 0.31
67 0.31
68 0.32
69 0.35
70 0.36
71 0.29
72 0.33
73 0.26
74 0.24
75 0.23
76 0.23
77 0.19
78 0.18
79 0.18
80 0.12
81 0.12
82 0.11
83 0.12
84 0.11
85 0.14
86 0.14
87 0.15
88 0.18
89 0.18
90 0.18
91 0.17
92 0.25
93 0.23
94 0.28
95 0.28
96 0.25
97 0.26
98 0.32
99 0.36
100 0.29
101 0.28
102 0.25
103 0.24
104 0.23
105 0.21
106 0.17
107 0.13
108 0.11
109 0.11
110 0.09
111 0.08
112 0.09
113 0.08