Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397HKS1

Protein Details
Accession A0A397HKS1    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
108-127SKSVRSKKTFRYKMKTHSGAHydrophilic
151-175TGVSRTRLRRLKKPAFATKGQRKILHydrophilic
NLS Segment(s)
PositionSequence
112-177RSKKTFRYKMKTHSGAKKRWRVTGGGKLKRWRVGKSHLNTGVSRTRLRRLKKPAFATKGQRKILKR
Subcellular Location(s) mito 17, nucl 8, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR021137  Ribosomal_L35  
IPR001706  Ribosomal_L35_non-mt  
IPR037229  Ribosomal_L35_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01632  Ribosomal_L35p  
Amino Acid Sequences MFSSFTRVSLGRKINSNFFLLTTKRLVPSTTQNSQQIQPIQQIGNEKITRFISTLTSKAFLFRSFESPNATTTTTTTALNYYHLLLCRPKLSFSIFNNVLSPNNNAFSKSVRSKKTFRYKMKTHSGAKKRWRVTGGGKLKRWRVGKSHLNTGVSRTRLRRLKKPAFATKGQRKILKRLLPYAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.49
3 0.48
4 0.4
5 0.35
6 0.36
7 0.3
8 0.3
9 0.27
10 0.27
11 0.27
12 0.27
13 0.26
14 0.25
15 0.34
16 0.38
17 0.39
18 0.41
19 0.44
20 0.46
21 0.46
22 0.48
23 0.42
24 0.36
25 0.35
26 0.32
27 0.28
28 0.27
29 0.3
30 0.26
31 0.3
32 0.29
33 0.26
34 0.27
35 0.27
36 0.27
37 0.23
38 0.22
39 0.19
40 0.2
41 0.22
42 0.2
43 0.2
44 0.19
45 0.21
46 0.21
47 0.17
48 0.17
49 0.17
50 0.21
51 0.21
52 0.22
53 0.25
54 0.24
55 0.24
56 0.23
57 0.22
58 0.17
59 0.16
60 0.19
61 0.15
62 0.14
63 0.13
64 0.12
65 0.12
66 0.12
67 0.12
68 0.1
69 0.1
70 0.1
71 0.11
72 0.12
73 0.12
74 0.14
75 0.13
76 0.13
77 0.13
78 0.17
79 0.21
80 0.22
81 0.28
82 0.27
83 0.27
84 0.27
85 0.26
86 0.23
87 0.19
88 0.2
89 0.13
90 0.14
91 0.14
92 0.14
93 0.14
94 0.15
95 0.2
96 0.25
97 0.31
98 0.35
99 0.4
100 0.44
101 0.53
102 0.62
103 0.67
104 0.69
105 0.71
106 0.72
107 0.76
108 0.81
109 0.79
110 0.76
111 0.76
112 0.75
113 0.75
114 0.78
115 0.78
116 0.72
117 0.69
118 0.63
119 0.58
120 0.57
121 0.58
122 0.59
123 0.58
124 0.61
125 0.61
126 0.64
127 0.66
128 0.63
129 0.57
130 0.53
131 0.54
132 0.58
133 0.57
134 0.62
135 0.6
136 0.59
137 0.55
138 0.53
139 0.51
140 0.45
141 0.45
142 0.39
143 0.43
144 0.48
145 0.54
146 0.58
147 0.62
148 0.69
149 0.73
150 0.79
151 0.8
152 0.8
153 0.81
154 0.83
155 0.82
156 0.81
157 0.8
158 0.78
159 0.72
160 0.74
161 0.76
162 0.73
163 0.68