Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2M1K0

Protein Details
Accession E2M1K0   
Localization Confidence High
Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
139-158QSFVWRRWIWTGRRRRRRSWHydrophilic
NLS Segment(s)
PositionSequence
73-81RGGRGRGRG
150-157GRRRRRRS
Subcellular Location(s) nucl 20, cyto 4, mito 1, extr 1, golg 1
Family & Domain DBs
KEGG mpr:MPER_13709  -  
Amino Acid Sequences ISGTVLPNPDGVPGSTYFSPFTQVNLPDIRNDRSLSVLYFFPKQLSPHRSVLLPGVRRPPRILSQEDIENSRRGGRGRGRGGGGGDWGGGRGGYNNDRSRGNNGNDPFHSRPSNYPPSGYGHDRNRGYQQDNYSSRRWQSFVWRRWIWTGRRRRRRSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.19
4 0.19
5 0.18
6 0.22
7 0.19
8 0.2
9 0.21
10 0.21
11 0.24
12 0.26
13 0.27
14 0.28
15 0.32
16 0.33
17 0.3
18 0.3
19 0.27
20 0.25
21 0.25
22 0.21
23 0.19
24 0.17
25 0.17
26 0.18
27 0.18
28 0.17
29 0.18
30 0.2
31 0.26
32 0.31
33 0.34
34 0.35
35 0.36
36 0.34
37 0.33
38 0.36
39 0.34
40 0.31
41 0.29
42 0.36
43 0.37
44 0.38
45 0.39
46 0.38
47 0.37
48 0.39
49 0.39
50 0.32
51 0.31
52 0.34
53 0.33
54 0.32
55 0.27
56 0.23
57 0.21
58 0.2
59 0.19
60 0.16
61 0.2
62 0.23
63 0.29
64 0.31
65 0.33
66 0.32
67 0.31
68 0.31
69 0.26
70 0.2
71 0.12
72 0.09
73 0.06
74 0.06
75 0.05
76 0.04
77 0.03
78 0.04
79 0.06
80 0.09
81 0.16
82 0.18
83 0.2
84 0.22
85 0.23
86 0.28
87 0.33
88 0.33
89 0.34
90 0.34
91 0.37
92 0.36
93 0.42
94 0.39
95 0.37
96 0.36
97 0.31
98 0.34
99 0.37
100 0.45
101 0.38
102 0.37
103 0.34
104 0.38
105 0.41
106 0.42
107 0.41
108 0.39
109 0.46
110 0.46
111 0.48
112 0.49
113 0.5
114 0.48
115 0.46
116 0.46
117 0.47
118 0.52
119 0.53
120 0.5
121 0.5
122 0.51
123 0.49
124 0.45
125 0.38
126 0.43
127 0.49
128 0.53
129 0.58
130 0.56
131 0.55
132 0.62
133 0.67
134 0.65
135 0.65
136 0.68
137 0.7
138 0.78