Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397HU61

Protein Details
Accession A0A397HU61    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
56-78LNFKECKKKWTVERREMRKKGLLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 10.5, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MTDMTDIPSATLPTHKVYKYKQNSQFLDPCQEQTLASMKCLEENNFAKHKCQAYFLNFKECKKKWTVERREMRKKGLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.29
4 0.34
5 0.44
6 0.5
7 0.58
8 0.63
9 0.66
10 0.68
11 0.68
12 0.69
13 0.6
14 0.58
15 0.49
16 0.41
17 0.33
18 0.3
19 0.24
20 0.19
21 0.23
22 0.17
23 0.16
24 0.16
25 0.14
26 0.16
27 0.18
28 0.17
29 0.17
30 0.2
31 0.24
32 0.28
33 0.29
34 0.28
35 0.32
36 0.35
37 0.29
38 0.3
39 0.31
40 0.32
41 0.42
42 0.42
43 0.48
44 0.47
45 0.5
46 0.56
47 0.52
48 0.51
49 0.48
50 0.53
51 0.53
52 0.61
53 0.69
54 0.69
55 0.78
56 0.84
57 0.89
58 0.87