Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397INL8

Protein Details
Accession A0A397INL8    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
19-42VSVEVKKWTKKRKRDEIEGRCKDDBasic
NLS Segment(s)
PositionSequence
28-31KKRK
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
Amino Acid Sequences METAVGMNHKDSLKMLAAVSVEVKKWTKKRKRDEIEGRCKDDENNNNNNNKGDDDSEDEDNDDGPGGYKRNKMSLDFILQGVCCN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.15
4 0.15
5 0.15
6 0.17
7 0.14
8 0.13
9 0.14
10 0.17
11 0.21
12 0.29
13 0.4
14 0.47
15 0.56
16 0.66
17 0.74
18 0.8
19 0.84
20 0.87
21 0.87
22 0.89
23 0.85
24 0.79
25 0.68
26 0.61
27 0.52
28 0.48
29 0.45
30 0.4
31 0.43
32 0.43
33 0.45
34 0.45
35 0.45
36 0.38
37 0.3
38 0.25
39 0.18
40 0.15
41 0.18
42 0.2
43 0.2
44 0.19
45 0.19
46 0.17
47 0.16
48 0.14
49 0.09
50 0.06
51 0.06
52 0.08
53 0.1
54 0.14
55 0.19
56 0.21
57 0.27
58 0.3
59 0.32
60 0.35
61 0.38
62 0.4
63 0.37
64 0.36
65 0.32