Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397GXH8

Protein Details
Accession A0A397GXH8    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MKKVHKTLKEKKALRKRKANKNENDLLIHydrophilic
NLS Segment(s)
PositionSequence
3-21KVHKTLKEKKALRKRKANK
Subcellular Location(s) nucl 25, cyto_nucl 15.5
Family & Domain DBs
Amino Acid Sequences MKKVHKTLKEKKALRKRKANKNENDLLIDEEKKKAAKIENDSSATNVRKKKSGGLSTSPPTKSQPSRNDGDNNDMESNVEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.88
3 0.88
4 0.88
5 0.92
6 0.91
7 0.89
8 0.87
9 0.84
10 0.75
11 0.67
12 0.56
13 0.48
14 0.4
15 0.34
16 0.26
17 0.2
18 0.19
19 0.17
20 0.17
21 0.17
22 0.19
23 0.23
24 0.28
25 0.33
26 0.36
27 0.37
28 0.37
29 0.36
30 0.35
31 0.31
32 0.3
33 0.3
34 0.27
35 0.28
36 0.29
37 0.35
38 0.39
39 0.43
40 0.43
41 0.44
42 0.49
43 0.5
44 0.56
45 0.5
46 0.43
47 0.4
48 0.42
49 0.43
50 0.46
51 0.5
52 0.49
53 0.52
54 0.56
55 0.6
56 0.56
57 0.56
58 0.5
59 0.46
60 0.41
61 0.37