Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397JDM6

Protein Details
Accession A0A397JDM6    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
26-48HDFSRLEKKKEEKRKEKEGEKGSBasic
NLS Segment(s)
PositionSequence
32-44EKKKEEKRKEKEG
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 5
Family & Domain DBs
Amino Acid Sequences MDSVCKTSPEKKVASGVYIRDEALNHDFSRLEKKKEEKRKEKEGEKGSVEINKNIEELSRRLIYICNKKGTTEGSNRHLVLHHGLYSIVLTTSACENRHIGNVATLRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.42
3 0.36
4 0.34
5 0.33
6 0.3
7 0.24
8 0.23
9 0.22
10 0.21
11 0.22
12 0.18
13 0.18
14 0.18
15 0.18
16 0.29
17 0.29
18 0.3
19 0.33
20 0.42
21 0.51
22 0.61
23 0.71
24 0.71
25 0.75
26 0.81
27 0.84
28 0.81
29 0.8
30 0.75
31 0.7
32 0.61
33 0.54
34 0.45
35 0.42
36 0.36
37 0.29
38 0.24
39 0.19
40 0.17
41 0.15
42 0.15
43 0.11
44 0.11
45 0.13
46 0.12
47 0.12
48 0.12
49 0.16
50 0.23
51 0.31
52 0.35
53 0.37
54 0.36
55 0.37
56 0.39
57 0.4
58 0.38
59 0.37
60 0.38
61 0.37
62 0.41
63 0.41
64 0.4
65 0.36
66 0.32
67 0.27
68 0.24
69 0.2
70 0.15
71 0.15
72 0.14
73 0.14
74 0.12
75 0.08
76 0.06
77 0.05
78 0.06
79 0.11
80 0.15
81 0.15
82 0.17
83 0.19
84 0.21
85 0.25
86 0.26
87 0.22
88 0.25