Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397JJT1

Protein Details
Accession A0A397JJT1    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
91-120LGIQNKKYNKSPTRKHKKQRSSIQHHPEGAHydrophilic
NLS Segment(s)
PositionSequence
102-108PTRKHKK
Subcellular Location(s) nucl 13, mito 11, cyto_nucl 9
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTQQQSQSYFLWSKSNTKQVSIISDVANNIFEYILLFLMAIFVSLCGSPSSGKTSGEQSSIPVHQLILVPHQNKRLYYHFFKKATGNEDILGIQNKKYNKSPTRKHKKQRSSIQHHPEGAIYAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.47
3 0.42
4 0.42
5 0.44
6 0.4
7 0.43
8 0.39
9 0.34
10 0.26
11 0.26
12 0.24
13 0.21
14 0.2
15 0.15
16 0.11
17 0.08
18 0.07
19 0.06
20 0.06
21 0.06
22 0.05
23 0.05
24 0.04
25 0.05
26 0.04
27 0.04
28 0.03
29 0.03
30 0.04
31 0.04
32 0.05
33 0.04
34 0.05
35 0.06
36 0.07
37 0.12
38 0.12
39 0.13
40 0.13
41 0.17
42 0.18
43 0.19
44 0.18
45 0.14
46 0.16
47 0.16
48 0.15
49 0.11
50 0.1
51 0.1
52 0.11
53 0.1
54 0.12
55 0.16
56 0.17
57 0.19
58 0.25
59 0.26
60 0.25
61 0.29
62 0.3
63 0.32
64 0.38
65 0.44
66 0.47
67 0.47
68 0.49
69 0.49
70 0.47
71 0.45
72 0.41
73 0.34
74 0.26
75 0.25
76 0.24
77 0.21
78 0.21
79 0.18
80 0.16
81 0.18
82 0.2
83 0.23
84 0.3
85 0.38
86 0.43
87 0.53
88 0.62
89 0.7
90 0.79
91 0.86
92 0.9
93 0.91
94 0.93
95 0.93
96 0.94
97 0.94
98 0.92
99 0.92
100 0.91
101 0.88
102 0.79
103 0.69
104 0.59