Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397G1J0

Protein Details
Accession A0A397G1J0    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
69-98REQRERERDRDREQRQRERRKSDQSVNESSBasic
NLS Segment(s)
PositionSequence
83-85RQR
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSVDEDYDGTAVDALVSMSEPVTSSTGAQKRSYSPKADDHEDRRDEKRSKPTPTTPRDEAQSPISEREREQRERERDRDREQRQRERRKSDQSVNESSTHSPHTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.05
8 0.06
9 0.07
10 0.08
11 0.08
12 0.16
13 0.2
14 0.23
15 0.24
16 0.25
17 0.29
18 0.38
19 0.41
20 0.38
21 0.38
22 0.43
23 0.46
24 0.49
25 0.51
26 0.48
27 0.52
28 0.51
29 0.51
30 0.46
31 0.5
32 0.47
33 0.47
34 0.52
35 0.5
36 0.52
37 0.54
38 0.6
39 0.62
40 0.65
41 0.65
42 0.58
43 0.53
44 0.49
45 0.45
46 0.38
47 0.31
48 0.3
49 0.24
50 0.25
51 0.25
52 0.24
53 0.24
54 0.3
55 0.34
56 0.35
57 0.41
58 0.46
59 0.54
60 0.61
61 0.68
62 0.69
63 0.69
64 0.72
65 0.76
66 0.75
67 0.76
68 0.78
69 0.81
70 0.83
71 0.87
72 0.88
73 0.87
74 0.87
75 0.87
76 0.87
77 0.86
78 0.85
79 0.81
80 0.79
81 0.73
82 0.66
83 0.58
84 0.5
85 0.43