Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397JC00

Protein Details
Accession A0A397JC00    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
9-36FTTVPKIPPKKQDHPPKKRCGQPPKTISHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MLTTIIKIFTTVPKIPPKKQDHPPKKRCGQPPKTISNMIQDDNEEELLSDNEDDNKNKDDYNNNNVMKMTKIMIM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.49
3 0.58
4 0.62
5 0.64
6 0.71
7 0.76
8 0.77
9 0.82
10 0.86
11 0.86
12 0.85
13 0.85
14 0.85
15 0.85
16 0.82
17 0.81
18 0.79
19 0.74
20 0.7
21 0.64
22 0.55
23 0.51
24 0.44
25 0.35
26 0.28
27 0.22
28 0.2
29 0.18
30 0.17
31 0.1
32 0.08
33 0.08
34 0.07
35 0.08
36 0.07
37 0.06
38 0.09
39 0.12
40 0.13
41 0.15
42 0.18
43 0.19
44 0.19
45 0.23
46 0.28
47 0.33
48 0.4
49 0.47
50 0.44
51 0.45
52 0.45
53 0.42
54 0.36
55 0.31