Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397G1Y7

Protein Details
Accession A0A397G1Y7    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-37TNIIALKLKRKRIRRLKEMSRVLNRTHydrophilic
NLS Segment(s)
PositionSequence
18-28KLKRKRIRRLK
Subcellular Location(s) mito 21, nucl 3.5, cyto_nucl 3.5
Family & Domain DBs
Amino Acid Sequences MKYFTNNPDLFTNIIALKLKRKRIRRLKEMSRVLNRTHLPVVNTIQERTFVKRRGIRIEVKGRLTKRYRADRSVYSLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.18
4 0.25
5 0.31
6 0.4
7 0.45
8 0.54
9 0.62
10 0.7
11 0.79
12 0.8
13 0.84
14 0.84
15 0.87
16 0.86
17 0.83
18 0.81
19 0.73
20 0.64
21 0.6
22 0.51
23 0.43
24 0.37
25 0.3
26 0.23
27 0.22
28 0.22
29 0.21
30 0.21
31 0.19
32 0.17
33 0.18
34 0.19
35 0.23
36 0.28
37 0.27
38 0.33
39 0.38
40 0.42
41 0.47
42 0.52
43 0.53
44 0.55
45 0.61
46 0.6
47 0.61
48 0.63
49 0.58
50 0.61
51 0.59
52 0.58
53 0.58
54 0.63
55 0.64
56 0.64
57 0.69
58 0.65