Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397J3Z0

Protein Details
Accession A0A397J3Z0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
66-92GICLVLRIKYKKKSKKEKVETYSKETDHydrophilic
NLS Segment(s)
PositionSequence
75-81YKKKSKK
Subcellular Location(s) plas 21, E.R. 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTFSFLIFFVILFIQFPPSTSAYVNTNRSSRWVFWGYDDGYRRCENICIIVFVIAAVLMVALCACGICLVLRIKYKKKSKKEKVETYSKETDGNSMDEIYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.14
5 0.14
6 0.16
7 0.16
8 0.18
9 0.19
10 0.25
11 0.29
12 0.29
13 0.29
14 0.28
15 0.31
16 0.32
17 0.29
18 0.29
19 0.28
20 0.25
21 0.25
22 0.3
23 0.28
24 0.3
25 0.33
26 0.27
27 0.28
28 0.27
29 0.26
30 0.21
31 0.21
32 0.16
33 0.16
34 0.16
35 0.13
36 0.12
37 0.12
38 0.11
39 0.1
40 0.09
41 0.04
42 0.03
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.03
55 0.06
56 0.08
57 0.12
58 0.18
59 0.25
60 0.32
61 0.42
62 0.52
63 0.59
64 0.68
65 0.76
66 0.81
67 0.87
68 0.9
69 0.92
70 0.9
71 0.91
72 0.87
73 0.83
74 0.79
75 0.68
76 0.61
77 0.5
78 0.45
79 0.36
80 0.32
81 0.26