Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IXN5

Protein Details
Accession A0A397IXN5    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
126-149DFLYKKTKKSIPKYTGRREKKLKTBasic
301-363QQQQPPTQQKCGRGRPRKNKYQQQKPPPQQKRCCGRPRKNQPQPQPQPQPQPQPQPQPQPQLQHydrophilic
NLS Segment(s)
PositionSequence
134-147KKSIPKYTGRREKK
Subcellular Location(s) nucl 17, cyto_nucl 10.5, mito 6, cyto 2
Family & Domain DBs
Amino Acid Sequences MHSRIRANISPNATAENIVKQAYIVADRDPLFKDTYSKTXQQHWIYMLYYLDLDYLKNILKQYSKFGHSYYDGKGKIIISRIRANISPNATAENIVKQAYIVADRDPLFKDTYSKTCHYPYSQTTLDFLYKKTKKSIPKYTGRREKKLKTYQLATLGEEIDLCYLPTAYNTSHLPKLGLCDACGFPLSNNNNAILTCNHGYHVLCYSGRCNYCENFYKIGIFENINSFLKRLEKGAEILTQEDFDNVEIEIEEKEETEEIESEKMDVSSLLIDAINKIETQYRKLQQQNLQPYPQLQQQHQQQQQPPTQQKCGRGRPRKNKYQQQKPPPQQKRCCGRPRKNQPQPQPQPQPQPQPQPQPQPQLQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.26
4 0.23
5 0.21
6 0.2
7 0.16
8 0.17
9 0.17
10 0.18
11 0.15
12 0.14
13 0.19
14 0.2
15 0.23
16 0.24
17 0.24
18 0.24
19 0.24
20 0.28
21 0.27
22 0.35
23 0.41
24 0.42
25 0.43
26 0.5
27 0.52
28 0.5
29 0.47
30 0.4
31 0.33
32 0.32
33 0.29
34 0.21
35 0.18
36 0.14
37 0.14
38 0.12
39 0.1
40 0.08
41 0.1
42 0.11
43 0.13
44 0.14
45 0.17
46 0.22
47 0.24
48 0.31
49 0.35
50 0.37
51 0.36
52 0.36
53 0.37
54 0.36
55 0.38
56 0.35
57 0.37
58 0.33
59 0.32
60 0.34
61 0.3
62 0.29
63 0.32
64 0.31
65 0.28
66 0.34
67 0.35
68 0.36
69 0.36
70 0.37
71 0.36
72 0.37
73 0.35
74 0.29
75 0.31
76 0.28
77 0.29
78 0.27
79 0.26
80 0.23
81 0.21
82 0.2
83 0.16
84 0.17
85 0.17
86 0.18
87 0.15
88 0.14
89 0.19
90 0.2
91 0.23
92 0.24
93 0.24
94 0.24
95 0.24
96 0.28
97 0.26
98 0.31
99 0.33
100 0.33
101 0.34
102 0.35
103 0.37
104 0.35
105 0.37
106 0.34
107 0.35
108 0.35
109 0.32
110 0.3
111 0.29
112 0.3
113 0.25
114 0.23
115 0.27
116 0.29
117 0.31
118 0.36
119 0.4
120 0.45
121 0.54
122 0.63
123 0.61
124 0.68
125 0.76
126 0.8
127 0.85
128 0.83
129 0.82
130 0.81
131 0.8
132 0.8
133 0.8
134 0.77
135 0.72
136 0.68
137 0.62
138 0.61
139 0.54
140 0.44
141 0.36
142 0.28
143 0.22
144 0.19
145 0.15
146 0.08
147 0.06
148 0.05
149 0.04
150 0.04
151 0.04
152 0.04
153 0.06
154 0.06
155 0.08
156 0.1
157 0.12
158 0.13
159 0.14
160 0.14
161 0.12
162 0.15
163 0.17
164 0.15
165 0.13
166 0.14
167 0.14
168 0.14
169 0.14
170 0.12
171 0.08
172 0.15
173 0.16
174 0.17
175 0.17
176 0.17
177 0.17
178 0.17
179 0.19
180 0.11
181 0.13
182 0.12
183 0.11
184 0.11
185 0.12
186 0.12
187 0.12
188 0.13
189 0.12
190 0.11
191 0.11
192 0.13
193 0.17
194 0.18
195 0.19
196 0.19
197 0.18
198 0.23
199 0.29
200 0.3
201 0.27
202 0.27
203 0.26
204 0.24
205 0.25
206 0.21
207 0.16
208 0.13
209 0.13
210 0.16
211 0.16
212 0.16
213 0.14
214 0.14
215 0.16
216 0.16
217 0.15
218 0.14
219 0.14
220 0.16
221 0.18
222 0.19
223 0.17
224 0.17
225 0.16
226 0.15
227 0.13
228 0.12
229 0.1
230 0.08
231 0.07
232 0.06
233 0.06
234 0.05
235 0.06
236 0.05
237 0.06
238 0.06
239 0.05
240 0.06
241 0.06
242 0.06
243 0.07
244 0.08
245 0.08
246 0.09
247 0.09
248 0.09
249 0.09
250 0.09
251 0.08
252 0.07
253 0.06
254 0.06
255 0.06
256 0.06
257 0.06
258 0.06
259 0.06
260 0.08
261 0.08
262 0.07
263 0.08
264 0.13
265 0.15
266 0.19
267 0.28
268 0.31
269 0.39
270 0.45
271 0.53
272 0.54
273 0.62
274 0.68
275 0.65
276 0.63
277 0.56
278 0.53
279 0.48
280 0.46
281 0.41
282 0.33
283 0.35
284 0.42
285 0.51
286 0.55
287 0.58
288 0.59
289 0.63
290 0.68
291 0.69
292 0.7
293 0.65
294 0.69
295 0.66
296 0.7
297 0.71
298 0.75
299 0.77
300 0.78
301 0.84
302 0.85
303 0.91
304 0.92
305 0.93
306 0.93
307 0.93
308 0.94
309 0.93
310 0.93
311 0.94
312 0.93
313 0.94
314 0.94
315 0.94
316 0.92
317 0.92
318 0.91
319 0.9
320 0.9
321 0.9
322 0.9
323 0.91
324 0.92
325 0.94
326 0.94
327 0.94
328 0.94
329 0.94
330 0.94
331 0.93
332 0.93
333 0.9
334 0.9
335 0.88
336 0.88
337 0.85
338 0.85
339 0.83
340 0.83
341 0.83
342 0.83
343 0.82
344 0.81