Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397JPR2

Protein Details
Accession A0A397JPR2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-27GKHLINCYLKERRKRNQIMKFKMIDNHydrophilic
92-115GWQLKNEQPLRKKEQRRTIHISNFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 13.833, mito 12.5, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MGKHLINCYLKERRKRNQIMKFKMIDNTEINDVKKSLIPGNKLRLKAVHHYLKKTVTRWLKNGFCIYSKYAKGMYTDGHLLIEKYSLKLWPGWQLKNEQPLRKKEQRRTIHISNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.82
3 0.85
4 0.86
5 0.89
6 0.87
7 0.87
8 0.8
9 0.72
10 0.66
11 0.57
12 0.51
13 0.42
14 0.36
15 0.32
16 0.31
17 0.29
18 0.25
19 0.24
20 0.21
21 0.2
22 0.19
23 0.19
24 0.21
25 0.25
26 0.3
27 0.39
28 0.43
29 0.42
30 0.41
31 0.39
32 0.38
33 0.39
34 0.42
35 0.42
36 0.4
37 0.42
38 0.44
39 0.47
40 0.46
41 0.41
42 0.41
43 0.41
44 0.41
45 0.43
46 0.47
47 0.43
48 0.43
49 0.44
50 0.37
51 0.3
52 0.29
53 0.28
54 0.26
55 0.24
56 0.23
57 0.22
58 0.22
59 0.22
60 0.2
61 0.18
62 0.15
63 0.16
64 0.14
65 0.14
66 0.13
67 0.12
68 0.1
69 0.12
70 0.1
71 0.1
72 0.11
73 0.11
74 0.12
75 0.14
76 0.16
77 0.23
78 0.29
79 0.31
80 0.33
81 0.39
82 0.43
83 0.51
84 0.56
85 0.55
86 0.56
87 0.61
88 0.68
89 0.72
90 0.77
91 0.77
92 0.81
93 0.82
94 0.83
95 0.83