Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397HT47

Protein Details
Accession A0A397HT47    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-55MITPPPPKKSRRAVRFLRKKNWKKQLQRLRPQQRPRPRPRLQPQHQQQHEHydrophilic
NLS Segment(s)
PositionSequence
9-45PPPPKKSRRAVRFLRKKNWKKQLQRLRPQQRPRPRPR
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
Amino Acid Sequences MNKEKMITPPPPKKSRRAVRFLRKKNWKKQLQRLRPQQRPRPRPRLQPQHQQQHEQETQQQEQQQQHEQNEQKQQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.79
4 0.79
5 0.8
6 0.81
7 0.88
8 0.89
9 0.88
10 0.89
11 0.89
12 0.9
13 0.9
14 0.88
15 0.87
16 0.88
17 0.89
18 0.89
19 0.89
20 0.89
21 0.89
22 0.88
23 0.88
24 0.87
25 0.86
26 0.86
27 0.86
28 0.85
29 0.81
30 0.83
31 0.84
32 0.85
33 0.82
34 0.83
35 0.82
36 0.82
37 0.79
38 0.75
39 0.67
40 0.64
41 0.59
42 0.51
43 0.47
44 0.42
45 0.41
46 0.38
47 0.4
48 0.37
49 0.39
50 0.41
51 0.45
52 0.45
53 0.46
54 0.51
55 0.53
56 0.55