Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397JPM8

Protein Details
Accession A0A397JPM8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
68-91GQKVRYQKIYTKKKCDIKKFTPVVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MLGDYTCYYIHNSGEVCGHGCRRPEGCFDHWKSKKRFPCKVCGKPTSSEPGLCRAHVKGYYVMKCLYGQKVRYQKIYTKKKCDIKKFTPVVIKKNSEESSLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.17
5 0.2
6 0.2
7 0.21
8 0.24
9 0.25
10 0.27
11 0.3
12 0.33
13 0.35
14 0.42
15 0.46
16 0.52
17 0.57
18 0.63
19 0.65
20 0.68
21 0.72
22 0.71
23 0.75
24 0.68
25 0.72
26 0.74
27 0.77
28 0.77
29 0.74
30 0.67
31 0.6
32 0.59
33 0.54
34 0.45
35 0.38
36 0.3
37 0.31
38 0.29
39 0.27
40 0.25
41 0.19
42 0.21
43 0.19
44 0.21
45 0.19
46 0.24
47 0.26
48 0.26
49 0.26
50 0.24
51 0.25
52 0.26
53 0.27
54 0.26
55 0.26
56 0.32
57 0.41
58 0.43
59 0.47
60 0.48
61 0.49
62 0.54
63 0.64
64 0.65
65 0.65
66 0.71
67 0.75
68 0.81
69 0.84
70 0.83
71 0.8
72 0.82
73 0.77
74 0.75
75 0.76
76 0.72
77 0.7
78 0.69
79 0.66
80 0.58
81 0.62
82 0.57