Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397JFJ8

Protein Details
Accession A0A397JFJ8    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
67-91IIIIFHNSKKKKQKRENENDARFIVHydrophilic
NLS Segment(s)
PositionSequence
75-80KKKKQK
Subcellular Location(s) nucl 9.5, cyto_nucl 6.5, mito 6, plas 4, pero 4, cyto 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNYIHPKLSFELEINKNCIFKTKVVLNIQKRLKKKVMGRLLVHSRKVFTGKTIYIKRIQNIFIIFIIIIIFHNSKKKKQKRENENDARFIVRDRRGVSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.35
4 0.33
5 0.37
6 0.3
7 0.25
8 0.28
9 0.29
10 0.35
11 0.42
12 0.51
13 0.51
14 0.57
15 0.63
16 0.64
17 0.62
18 0.61
19 0.59
20 0.57
21 0.59
22 0.6
23 0.61
24 0.61
25 0.6
26 0.6
27 0.65
28 0.62
29 0.58
30 0.49
31 0.4
32 0.34
33 0.34
34 0.27
35 0.19
36 0.19
37 0.18
38 0.24
39 0.26
40 0.28
41 0.32
42 0.34
43 0.35
44 0.34
45 0.33
46 0.28
47 0.26
48 0.25
49 0.18
50 0.17
51 0.13
52 0.1
53 0.09
54 0.06
55 0.06
56 0.07
57 0.08
58 0.09
59 0.17
60 0.2
61 0.29
62 0.4
63 0.5
64 0.59
65 0.69
66 0.78
67 0.81
68 0.89
69 0.92
70 0.92
71 0.9
72 0.83
73 0.75
74 0.66
75 0.55
76 0.49
77 0.46
78 0.4
79 0.39