Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397J1M0

Protein Details
Accession A0A397J1M0    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MGCNERREKKGKQRRNRRNRRNIDEEWLKBasic
NLS Segment(s)
PositionSequence
6-21RREKKGKQRRNRRNRR
Subcellular Location(s) nucl 19.5, cyto_nucl 14, mito 4
Family & Domain DBs
Amino Acid Sequences MGCNERREKKGKQRRNRRNRRNIDEEWLKIGLIHFYNNNFETIKLEIFEPPTSKFYFISNNLLPQSLSFPQLLHSQNLSSPSISSTVTSTELLNYPSSPLPKNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.94
3 0.96
4 0.96
5 0.96
6 0.96
7 0.94
8 0.91
9 0.83
10 0.81
11 0.77
12 0.67
13 0.6
14 0.49
15 0.39
16 0.31
17 0.27
18 0.21
19 0.14
20 0.14
21 0.12
22 0.13
23 0.16
24 0.16
25 0.17
26 0.14
27 0.14
28 0.15
29 0.14
30 0.13
31 0.1
32 0.1
33 0.1
34 0.12
35 0.13
36 0.12
37 0.13
38 0.15
39 0.15
40 0.15
41 0.14
42 0.14
43 0.18
44 0.19
45 0.23
46 0.21
47 0.24
48 0.23
49 0.23
50 0.22
51 0.17
52 0.19
53 0.14
54 0.15
55 0.12
56 0.12
57 0.13
58 0.2
59 0.21
60 0.19
61 0.19
62 0.18
63 0.19
64 0.22
65 0.21
66 0.16
67 0.14
68 0.14
69 0.14
70 0.14
71 0.13
72 0.11
73 0.12
74 0.14
75 0.14
76 0.13
77 0.14
78 0.15
79 0.16
80 0.16
81 0.15
82 0.16
83 0.19
84 0.23