Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397JUC6

Protein Details
Accession A0A397JUC6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
17-43ECKLCNKIYKRPSGLKKHKKIIKDLNTHydrophilic
NLS Segment(s)
PositionSequence
29-36SGLKKHKK
Subcellular Location(s) nucl 12, mito 10, cyto_nucl 9.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MTDFKTKNKTLPCKTLECKLCNKIYKRPSGLKKHKKIIKDLNTIKPSIYILPEKAIEETRQMLVYHIKEKLKQNSRHVGNVSVTISDTESQFFGVFKGYIHNYFPKSGTYKCIFKEKLKQNSRHVGNVSVTIGGTESQFFGVFKGYIHNYFPKSGTYKCIFKGADAYSTLAHILKDENWGVKYFLQHQKTFVLLNSNNQDSLQESYLNKENQEPDPLQELDPLQELDPLQEPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.72
3 0.71
4 0.66
5 0.66
6 0.64
7 0.67
8 0.66
9 0.68
10 0.69
11 0.69
12 0.74
13 0.73
14 0.75
15 0.76
16 0.79
17 0.85
18 0.86
19 0.87
20 0.87
21 0.85
22 0.81
23 0.81
24 0.8
25 0.79
26 0.79
27 0.77
28 0.77
29 0.75
30 0.69
31 0.59
32 0.5
33 0.41
34 0.32
35 0.28
36 0.21
37 0.19
38 0.21
39 0.22
40 0.21
41 0.22
42 0.22
43 0.19
44 0.17
45 0.19
46 0.17
47 0.17
48 0.17
49 0.16
50 0.2
51 0.22
52 0.23
53 0.26
54 0.27
55 0.31
56 0.38
57 0.47
58 0.51
59 0.56
60 0.6
61 0.65
62 0.66
63 0.66
64 0.59
65 0.53
66 0.44
67 0.39
68 0.32
69 0.22
70 0.19
71 0.14
72 0.14
73 0.11
74 0.1
75 0.08
76 0.07
77 0.07
78 0.08
79 0.07
80 0.06
81 0.07
82 0.07
83 0.06
84 0.09
85 0.1
86 0.11
87 0.13
88 0.17
89 0.17
90 0.18
91 0.19
92 0.19
93 0.2
94 0.2
95 0.23
96 0.23
97 0.25
98 0.25
99 0.33
100 0.33
101 0.34
102 0.44
103 0.47
104 0.54
105 0.59
106 0.64
107 0.62
108 0.69
109 0.68
110 0.63
111 0.56
112 0.49
113 0.42
114 0.37
115 0.3
116 0.21
117 0.17
118 0.12
119 0.1
120 0.07
121 0.06
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.06
129 0.06
130 0.06
131 0.09
132 0.1
133 0.11
134 0.13
135 0.17
136 0.17
137 0.18
138 0.19
139 0.19
140 0.2
141 0.2
142 0.23
143 0.23
144 0.25
145 0.25
146 0.31
147 0.28
148 0.26
149 0.32
150 0.27
151 0.27
152 0.25
153 0.25
154 0.18
155 0.18
156 0.18
157 0.13
158 0.11
159 0.09
160 0.09
161 0.09
162 0.12
163 0.13
164 0.15
165 0.16
166 0.17
167 0.18
168 0.19
169 0.2
170 0.25
171 0.33
172 0.36
173 0.36
174 0.37
175 0.37
176 0.37
177 0.35
178 0.28
179 0.28
180 0.24
181 0.3
182 0.33
183 0.33
184 0.32
185 0.3
186 0.3
187 0.23
188 0.26
189 0.2
190 0.19
191 0.18
192 0.22
193 0.29
194 0.3
195 0.29
196 0.3
197 0.33
198 0.32
199 0.38
200 0.35
201 0.31
202 0.35
203 0.36
204 0.31
205 0.3
206 0.28
207 0.23
208 0.24
209 0.22
210 0.17
211 0.18
212 0.17
213 0.17